You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00870
Secondary Accession Numbers
  • 6152
  • HMDBP05476
Name Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA
Synonyms
  1. Alpha-1,2-mannosidase IA
  2. Man(9)-alpha-mannosidase
  3. Man9-mannosidase
  4. Mannosidase alpha class 1A member 1
  5. Processing alpha-1,2-mannosidase IA
Gene Name MAN1A1
Protein Type Unknown
Biological Properties
General Function Involved in mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
Specific Function Involved in the maturation of Asn-linked oligosaccharides. Progressively trim alpha-1,2-linked mannose residues from Man(9)GlcNAc(2) to produce Man(5)GlcNAc(2).
Pathways
  • N-Glycan biosynthesis
  • protein glycosylation
  • Protein processing in endoplasmic reticulum
Reactions
+ Water → + D-Mannose details
Water + → D-Mannose + details
GO Classification
Biological Process
post-translational protein modification
protein N-linked glycosylation via asparagine
Cellular Component
endoplasmic reticulum
endoplasmic reticulum-Golgi intermediate compartment
integral to membrane
Golgi membrane
Component
membrane
cell part
Function
mannosidase activity
mannosyl-oligosaccharide mannosidase activity
ion binding
mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing o-glycosyl compounds
calcium ion binding
Molecular Function
mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
calcium ion binding
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 6
Locus 6q22
SNPs MAN1A1
Gene Sequence
>1962 bp
ATGCCCGTGGGGGGCCTGTTGCCGCTCTTCAGCAGCCCCGCGGGCGGCGTCCTGGGCGGG
GGGCTCGGCGGCGGCGGTGGCAGGAAGGGGTCGGGCCCCGCCGCCCTCCGCCTGACGGAG
AAGTTCGTGCTGCTGCTGGTATTCAGCGCCTTCATCACGCTCTGCTTCGGGGCGATCTTC
TTCCTGCCAGACTCCTCCAAGCTGCTCAGCGGGGTCCTGTTCCACTCCAGCCCCGCCTTG
CAGCCGGCCGCCGACCACAAGCCCGGGCCCGGGGCGCGCGCCGAGGACGCGGCCGAGGGG
CGAGCCCGGCGCCGCGAGGAGGGGGCACCCGGGGACCCGGAGGCCGCCCTGGAGGACAAC
TTGGCCAGGATCCGCGAAAACCACGAGCGGGCTCTCAGGGAAGCCAAGGAGACCCTGCAG
AAGCTGCCCGAGGAGATCCAAAGAGACATCCTACTGGAGAAGAAGAAGGTGGCCCAGGAC
CAGCTGCGTGACAAGGCGCCGTTCAGAGGCCTGCCCCCGGTGGACTTCGTGCCCCCAATC
GGGGTGGAGAGCCGGGAGCCCGCCGACGCCGCCATCCGCGAGAAAAGGGCAAAGATCAAA
GAGATGATGAAACATGCTTGGAATAATTATAAAGGTTATGCCTGGGGATTAAATGAACTC
AAACCTATATCAAAAGGAGGCCATTCAAGCAGTTTGTTTGGTAACATCAAAGGAGCAACT
ATAGTAGATGCCCTGGATACACTTTTTATTATGGAAATGAAACATGAATTTGAAGAAGCA
AAATCATGGGTTGAAGAAAATTTAGATTTTAATGTGAATGCTGAAATTTCTGTCTTTGAA
GTAAATATACGCTTTGTTGGTGGACTACTCTCAGCCTACTATCTGTCTGGAGAAGAGATT
TTTCGAAAGAAAGCAGTGGAACTTGGGGTAAAATTGCTACCTGCATTTCATACTCCCTCT
GGAATACCTTGGGCATTGCTGAATATGAAAAGTGGTATTGGAAGGAACTGGCCCTGGGCC
TCTGGAGGCAGCAGTATTCTGGCAGAATTTGGAACCCTGCATTTGGAGTTTATGCACTTG
AGCCACTTATCAGGAAACCCCATCTTTGCTGAAAAGGTAATGAATATTCGAACAGTACTG
AACAAACTGGAAAAACCACAAGGCCTTTATCCTAACTATCTGAATCCCAGTAGTGGACAG
TGGGGTCAACATCATGTATCAGTTGGAGGACTTGGAGACAGCTTCTATGAGTATTTGCTG
AAGGCCTGGTTAATGTCTGACAAGACAGATCTGGAAGCTAAGAAGATGTATTTTGATGCT
GTTCAGGCTATCGAGACTCATTTGATCCGCAAGTCTAGCAGCGGACTAACTTATATCGCA
GAGTGGAAAGGGGGCCTCCTGGAGCACAAGATGGGCCACCTGACCTGCTTCGCGGGGGGC
ATGTTCGCACTCGGGGCTGATGCAGCTCCCGAAGGCATGGCCCAACACTACCTTGAACTC
GGGGCTGAAATTGCCCGTACTTGTCATGAATCATATAATCGAACATTTATGAAACTGGGA
CCAGAAGCTTTCAGATTTGATGGTGGTGTTGAAGCCATCGCTACAAGACAAAATGAAAAA
TACTACATCTTACGGCCAGAAGTTATGGAGACTTACATGTATATGTGGAGACTGACTCAT
GATCCAAAGTACAGGAAATGGGCCTGGGAAGCCGTAGAGGCCTTGGAAAACCATTGCAGA
GTGAATGGAGGCTATTCAGGCCTAAGGGATGTTTACCTTCTTCATGAGAGTTATGATGAT
GTGCAGCAGAGTTTCTTCCTGGCAGAGACATTGAAATATTTGTACCTAATATTTTCTGAC
GACGATCTTCTTCCACTGGAGCATTGGATCTTCAATAGCGAGGCACATCTTCTCCCTATC
CTCCCTAAAGATAAAAAGGAAGTTGAAATCAGAGAGGAATAA
Protein Properties
Number of Residues 653
Molecular Weight 72967.88
Theoretical pI 6.471
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA
MPVGGLLPLFSSPAGGVLGGGLGGGGGRKGSGPAALRLTEKFVLLLVFSAFITLCFGAIF
FLPDSSKLLSGVLFHSSPALQPAADHKPGPGARAEDAAEGRARRREEGAPGDPEAALEDN
LARIRENHERALREAKETLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPI
GVESREPADAAIREKRAKIKEMMKHAWNNYKGYAWGLNELKPISKGGHSSSLFGNIKGAT
IVDALDTLFIMEMKHEFEEAKSWVEENLDFNVNAEISVFEVNIRFVGGLLSAYYLSGEEI
FRKKAVELGVKLLPAFHTPSGIPWALLNMKSGIGRNWPWASGGSSILAEFGTLHLEFMHL
SHLSGNPIFAEKVMNIRTVLNKLEKPQGLYPNYLNPSSGQWGQHHVSVGGLGDSFYEYLL
KAWLMSDKTDLEAKKMYFDAVQAIETHLIRKSSSGLTYIAEWKGGLLEHKMGHLTCFAGG
MFALGADAAPEGMAQHYLELGAEIARTCHESYNRTFMKLGPEAFRFDGGVEAIATRQNEK
YYILRPEVMETYMYMWRLTHDPKYRKWAWEAVEALENHCRVNGGYSGLRDVYLLHESYDD
VQQSFFLAETLKYLYLIFSDDDLLPLEHWIFNSEAHLLPILPKDKKEVEIREE
GenBank ID Protein 56202626
UniProtKB/Swiss-Prot ID P33908
UniProtKB/Swiss-Prot Entry Name MA1A1_HUMAN
PDB IDs Not Available
GenBank Gene ID AL022722
GeneCard ID MAN1A1
GenAtlas ID MAN1A1
HGNC ID HGNC:6821
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  3. Bause E, Bieberich E, Rolfs A, Volker C, Schmidt B: Molecular cloning and primary structure of Man9-mannosidase from human kidney. Eur J Biochem. 1993 Oct 15;217(2):535-40. [PubMed:8223597 ]