You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00902
Secondary Accession Numbers
  • 6190
Name dTDP-D-glucose 4,6-dehydratase
Synonyms Not Available
Gene Name TGDS
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Not Available
Pathways Not Available
Reactions
dTDP-D-glucose → 4,6-Dideoxy-4-oxo-dTDP-D-glucose + Water details
GO Classification
Biological Process
nucleotide-sugar metabolic process
Function
binding
catalytic activity
coenzyme binding
cofactor binding
Molecular Function
dTDP-glucose 4,6-dehydratase activity
nucleotide binding
coenzyme binding
Process
metabolic process
cellular metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 13
Locus 13q32.1
SNPs TGDS
Gene Sequence
>1053 bp
ATGTCGGCGGCGTGTTGGGAGGAACCGTGGGGTCTTCCCGGCGGCTTTGCGAAGCGGGTC
CTGGTGACCGGCGGTGCTGGTTTCATTGCATCACATATGATTGTCTCTTTAGTGGAAGAT
TATCCAAACTATATGATCATAAATCTAGACAAGCTGGATTACTGTGCAAGCTTGAAGAAT
CTTGAAACCATTTCTAACAAACAGAACTACAAATTTATACAGGGTGACATATGTGATTCT
CACTTTGTGAAACTGCTTTTTGAAACAGAGAAAATAGATATAGTACTACATTTTGCCGCA
CAAACACATGTAGATCTTTCATTCGTACGTGCCTTTGAGTTTACCTATGTTAATGTTTAT
GGCACTCACGTTTTGGTAAGTGCTGCTCATGAAGCCAGAGTGGAGAAGTTTATTTATGTC
AGCACAGATGAAGTATATGGTGGCAGTCTTGATAAGGAATTTGATGAATCTTCACCCAAA
CAACCTACAAATCCTTATGCATCATCTAAAGCAGCTGCTGAATGTTTTGTACAGTCTTAC
TGGGAACAATATAAGTTTCCAGTTGTCATCACAAGAAGCAGTAATGTTTATGGACCACAT
CAATATCCAGAAAAGGTTATTCCAAAATTTATATCTTTGCTACAGCACAACAGGAAATGT
TGCATTCATGGGTCAGGGCTTCAAACAAGAAACTTCCTTTATGCTACTGATGTTGTAGAA
GCATTTCTCACTGTCCTCAAAAAAGGGAAACCAGGTGAAATTTATAACATCGGAACCAAT
TTTGAAATGTCAGTTGTCCAGCTTGCCAAAGAACTAATACAACTGATCAAAGAGACCAAT
TCAGAGTCTGAAATGGAAAATTGGGTTGATTATGTTAATGATAGACCCACCAATGACATG
AGATACCCAATGAAGTCAGAAAAAATACATGGCTTAGGATGGAGACCTAAAGTGCCTTGG
AAAGAAGGAATAAAGAAAACAATTGAATGGTACAGAGAGAATTTTCACAACTGGAAGAAT
GTGGAAAAGGCATTAGAACCCTTTCCGGTATAA
Protein Properties
Number of Residues 350
Molecular Weight 40213.665
Theoretical pI 6.601
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>dTDP-D-glucose 4,6-dehydratase
MSAACWEEPWGLPGGFAKRVLVTGGAGFIASHMIVSLVEDYPNYMIINLDKLDYCASLKN
LETISNKQNYKFIQGDICDSHFVKLLFETEKIDIVLHFAAQTHVDLSFVRAFEFTYVNVY
GTHVLVSAAHEARVEKFIYVSTDEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSY
WEQYKFPVVITRSSNVYGPHQYPEKVIPKFISLLQHNRKCCIHGSGLQTRNFLYATDVVE
AFLTVLKKGKPGEIYNIGTNFEMSVVQLAKELIQLIKETNSESEMENWVDYVNDRPTNDM
RYPMKSEKIHGLGWRPKVPWKEGIKKTIEWYRENFHNWKNVEKALEPFPV
GenBank ID Protein 5737699
UniProtKB/Swiss-Prot ID O95455
UniProtKB/Swiss-Prot Entry Name TGDS_HUMAN
PDB IDs Not Available
GenBank Gene ID AF048686
GeneCard ID TGDS
GenAtlas ID TGDS
HGNC ID HGNC:20324
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823 ]