You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00911
Secondary Accession Numbers
  • 6199
  • HMDBP06715
Name NAD(P) transhydrogenase, mitochondrial
Synonyms
  1. Nicotinamide nucleotide transhydrogenase
  2. Pyridine nucleotide transhydrogenase
Gene Name NNT
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function The transhydrogenation between NADH and NADP is coupled to respiration and ATP hydrolysis and functions as a proton pump across the membrane. May play a role in reactive oxygen species (ROS) detoxification in the adrenal gland.
Pathways
  • Nicotinate and Nicotinamide Metabolism
  • Nicotinate and nicotinamide metabolism
Reactions
NADPH + NAD → NADP + NADH details
GO Classification
Biological Process
small molecule metabolic process
reactive oxygen species metabolic process
tricarboxylic acid cycle
Cellular Component
mitochondrial respiratory chain
integral to membrane
Function
binding
catalytic activity
nad(p)+ transhydrogenase activity
oxidoreductase activity, acting on nadh or nadph, nad or nadp as acceptor
nad(p)+ transhydrogenase (ab-specific) activity
oxidoreductase activity
oxidoreductase activity, acting on nadh or nadph
Molecular Function
NAD binding
NADP binding
NAD(P)+ transhydrogenase (AB-specific) activity
NAD(P)+ transhydrogenase (B-specific) activity
Process
metabolic process
hydrogen transport
proton transport
establishment of localization
transport
oxidation reduction
Cellular Location
  1. Mitochondrion inner membrane
  2. Multi-pass membrane protein
  3. Matrix side (Potential)
Gene Properties
Chromosome Location 5
Locus 5p12
SNPs NNT
Gene Sequence
>3261 bp
ATGGCAAACCTATTGAAAACAGTGGTGACTGGCTGCTCGTGTCCTCTACTTAGCAATTTG
GGGTCCTGTAAGGGTCTACGTGTGAAGAAGGATTTTTTACGAACATTTTATACTCACCAA
GAACTGTGGTGTAAAGCGCCTGTAAAACCAGGAATTCCATATAAGCAACTGACTGTTGGA
GTCCCCAAAGAGATATTCCAAAATGAGAAGCGAGTGGCATTGTCTCCTGCTGGTGTTCAG
AACTTGGTCAAGCAGGGTTTTAATGTTGTCGTGGAATCGGGTGCGGGCGAAGCTTCCAAG
TTCTCAGATGATCACTATAGAGTGGCAGGTGCCCAAATCCAAGGGGCAAAGGAAGTGCTG
GCTTCTGATTTGGTGGTCAAAGTGCGAGCCCCTATGGTTAATCCAACATTAGGTGTTCAT
GAAGCTGACCTTTTAAAGACATCAGGAACGCTGATTAGTTTTATTTACCCAGCCCAAAAT
CCAGAGTTGCTAAATAAACTTTCCCAAAGAAAAACTACAGTTCTGGCAATGGACCAGGTT
CCAAGAGTCACAATTGCTCAGGGATATGATGCGCTAAGCTCCATGGCCAACATTGCGGGT
TATAAGGCTGTTGTCCTAGCAGCAAATCATTTTGAACGTTTTTTTACTGGTCAGATCACA
GCTGCTGGAAAAGTTCCTCCAGCTAAGATTCTGATAGTTGGTGGTGGTGTTGCTGGGCTT
GCTTCTGCAGGCGCAGCAAAGTCGATGGGTGCAATTGTTCGAGGATTTGACACAAGAGCT
GCAGCTTTGGAACAGTTCAAGTCTCTTGGTGCTGAGCCCTTGGAGGTGGACTTGAAGGAA
TCTGGTGAGGGACAAGGAGGATATGCAAAAGAGATGTCCAAAGAGTTCATTGAAGCTGAA
ATGAAACTCTTTGCTCAACAATGCAAGGAGGTAGACATCCTTATCAGCACAGCACTTATT
CCAGGTAAAAAAGCTCCAGTTTTATTTAATAAAGAAATGATTGAGTCAATGAAGGAAGGT
TCAGTTGTTGTGGATTTAGCTGCTGAGGCTGGTGGAAACTTTGAAACCACTAAGCCAGGA
GAACTCTACATTCATAAGGGAATTACTCACATAGGCTACACAGACCTGCCCAGCCGAATG
GCCACTCAGGCCAGCACCCTATATTCCAACAACATCACCAAACTCCTGAAGGCCATCAGC
CCGGACAAAGATAATTTTTATTTTGATGTGAAAGATGACTTTGACTTTGGTACGATGGGT
CATGTCATTAGAGGAACTGTAGTGATGAAAGATGGTAAAGTGATTTTCCCAGCTCCCACA
CCGAAAAATATTCCTCAAGGTGCCCCAGTAAAACAGAAGACAGTGGCTGAGCTGGAAGCT
GAAAAAGCAGCTACCATTACACCCTTCAGGAAGACAATGTCAACGGCTTCTGCATATACA
GCAGGTCTCACAGGGATACTGGGTTTGGGCATTGCGGCTCCCAATCTAGCCTTTTCTCAG
ATGGTGACCACTTTTGGCTTGGCTGGCATTGTGGGGTATCATACCGTCTGGGGAGTGACC
CCTGCTCTCCACTCACCACTGATGTCTGTGACAAATGCAATCTCAGGGCTGACTGCAGTT
GGTGGGTTGGCACTGATGGGAGGACATTTGTATCCTTCCACAACTTCTCAGGGCCTTGCT
GCTCTTGCTGCATTCATATCCTCTGTCAACATTGCAGGTGGCTTTCTGGTGACTCAGAGA
ATGCTGGACATGTTCAAGCGTCCCACTGACCCCCCAGAATACAACTACCTGTACCTGCTC
CCTGCCGGCACCTTTGTTGGTGGATATTTAGCTGCCCTCTACAGTGGTTATAACATTGAA
CAGATCATGTACCTAGGCTCGGGTTTGTGCTGTGTCGGTGCCTTGGCTGGCCTCTCCACC
CAGGGAACAGCACGTCTTGGCAATGCACTGGGCATGATTGGGGTTGCTGGAGGACTGGCA
GCCACCCTCGGAGTCCTAAAACCGGGCCCAGAATTACTAGCTCAGATGTCTGGAGCGATG
GCTTTGGGTGGTACCATTGGATTGACAATTGCCAAACGCATCCAGATTTCTGATTTACCT
CAATTAGTTGCTGCTTTTCACAGTTTAGTGGGTTTGGCAGCTGTACTTACTTGCATAGCT
GAGTACATTATAGAATATCCACATTTTGCTACGGACGCAGCAGCAAATCTCACCAAGATT
GTGGCCTACCTCGGCACTTACATTGGTGGCGTCACCTTTAGTGGGTCTCTCATTGCCTAT
GGAAAATTGCAGGGTCTCCTGAAATCTGCCCCTCTCCTACTGCCTGGAAGGCACTTACTC
AATGCAGGCTTACTGGCTGCTAGTGTGGGCGGGATAATCCCATTCATGGTGGACCCAAGC
TTTACTACTGGCATCACCTGTCTGGGTTCAGTGTCTGCTCTCTCTGCTGTCATGGGTGTG
ACTTTGACAGCTGCTATTGGGGGTGCTGACATGCCCGTCGTTATCACTGTGCTGAACAGC
TACTCAGGCTGGGCCCTGTGTGCAGAGGGCTTCCTGCTCAACAACAATCTGCTGACCATC
GTGGGTGCACTCATAGGCTCGTCTGGTGCTATCCTGTCATACATCATGTGTGTGGCAATG
AATCGCTCCCTGGCTAATGTGATTCTTGGAGGCTATGGCACCACTTCAACAGCTGGTGGA
AAACCCATGGAAATTTCTGGCACACATACGGAAATCAACCTTGACAATGCAATTGACATG
ATTCGAGAAGCTAATAGCATTATTATTACACCAGGCTATGGTCTCTGTGCAGCCAAAGCT
CAATACCCCATTGCTGATTTGGTAAAGATGCTCACTGAGCAAGGCAAAAAAGTCAGGTTT
GGAATTCACCCAGTTGCAGGCCGAATGCCTGGTCAGCTTAATGTGCTGCTGGCTGAGGCT
GGTGTGCCATATGACATTGTGTTGGAAATGGATGAGATCAACCATGATTTTCCAGATACT
GATTTGGTCCTTGTAATTGGAGCTAATGACACTGTTAATTCAGCAGCTCAAGAAGATCCC
AACTCTATTATTGCAGGCATGCCAGTCCTTGAGGTCTGGAAATCAAAGCAGGTGATTGTT
ATGAAGAGGTCTTTGGGTGTTGGCTATGCTGCAGTGGACAATCCAATCTTCTACAGACCT
AACACGGCCATGCTTCTAGGTGATGCCAAGAAAACATGTGACGCGCTCCAGGCGAAAGTT
AGAGAATCCTATCAGAAGTAA
Protein Properties
Number of Residues 1086
Molecular Weight 113894.595
Theoretical pI 8.094
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>NAD(P) transhydrogenase, mitochondrial
MANLLKTVVTGCSCPLLSNLGSCKGLRVKKDFLRTFYTHQELWCKAPVKPGIPYKQLTVG
VPKEIFQNEKRVALSPAGVQNLVKQGFNVVVESGAGEASKFSDDHYRVAGAQIQGAKEVL
ASDLVVKVRAPMVNPTLGVHEADLLKTSGTLISFIYPAQNPELLNKLSQRKTTVLAMDQV
PRVTIAQGYDALSSMANIAGYKAVVLAANHFGRFFTGQITAAGKVPPAKILIVGGGVAGL
ASAGAAKSMGAIVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAE
MKLFAQQCKEVDILISTALIPGKKAPVLFNKEMIESMKEGSVVVDLAAEAGGNFETTKPG
ELYIHKGITHIGYTDLPSRMATQASTLYSNNITKLLKAISPDKDNFYFDVKDDFDFGTMG
HVIRGTVVMKDGKVIFPAPTPKNIPQGAPVKQKTVAELEAEKAATITPFRKTMSTASAYT
AGLTGILGLGIAAPNLAFSQMVTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGLTAV
GGLALMGGHLYPSTTSQGLAALAAFISSVNIAGGFLVTQRMLDMFKRPTDPPEYNYLYLL
PAGTFVGGYLAALYSGYNIEQIMYLGSGLCCVGALAGLSTQGTARLGNALGMIGVAGGLA
ATLGVLKPGPELLAQMSGAMALGGTIGLTIAKRIQISDLPQLVAAFHSLVGLAAVLTCIA
EYIIEYPHFATDAAANLTKIVAYLGTYIGGVTFSGSLIAYGKLQGLLKSAPLLLPGRHLL
NAGLLAASVGGIIPFMVDPSFTTGITCLGSVSALSAVMGVTLTAAIGGADMPVVITVLNS
YSGWALCAEGFLLNNNLLTIVGALIGSSGAILSYIMCVAMNRSLANVILGGYGTTSTAGG
KPMEISGTHTEINLDNAIDMIREANSIIITPGYGLCAAKAQYPIADLVKMLTEQGKKVRF
GIHPVAGRMPGQLNVLLAEAGVPYDIVLEMDEINHDFPDTDLVLVIGANDTVNSAAQEDP
NSIIAGMPVLEVWKSKQVIVMKRSLGVGYAAVDNPIFYKPNTAMLLGDAKKTCDALQAKV
RESYQK
GenBank ID Protein 21732286
UniProtKB/Swiss-Prot ID Q13423
UniProtKB/Swiss-Prot Entry Name NNTM_HUMAN
PDB IDs
GenBank Gene ID AL831822
GeneCard ID NNT
GenAtlas ID NNT
HGNC ID HGNC:7863
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Zieger B, Ware J: Cloning and deduced amino acid sequence of human nicotinamide nucleotide transhydrogenase. DNA Seq. 1997;7(6):369-73. [PubMed:9524818 ]
  5. Arkblad EL, Betsholtz C, Rydstrom J: The cDNA sequence of proton-pumping nicotinamide nucleotide transhydrogenase from man and mouse. Biochim Biophys Acta. 1996 Mar 28;1273(3):203-5. [PubMed:8616157 ]
  6. White SA, Peake SJ, McSweeney S, Leonard G, Cotton NP, Jackson JB: The high-resolution structure of the NADP(H)-binding component (dIII) of proton-translocating transhydrogenase from human heart mitochondria. Structure. 2000 Jan 15;8(1):1-12. [PubMed:10673423 ]