You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00912
Secondary Accession Numbers
  • 6200
Name Tankyrase-1
Synonyms
  1. Poly [ADP-ribose] polymerase 5A
  2. TANK1
  3. TNKS-1
  4. TRF1-interacting ankyrin-related ADP-ribose polymerase
  5. Tankyrase I
  6. ADP-ribosyltransferase diphtheria toxin-like 5
  7. ARTD5
Gene Name TNKS
Protein Type Unknown
Biological Properties
General Function Involved in NAD+ ADP-ribosyltransferase activity
Specific Function Poly-ADP-ribosyltransferase involved in various processes such as Wnt signaling pathway, telomere length and vesicle trafficking. Acts as an activator of the Wnt signaling pathway by mediating poly-ADP-ribosylation (PARsylation) of AXIN1 and AXIN2, 2 key components of the beta-catenin destruction complex: poly-ADP-ribosylated target proteins are recognized by RNF146, which mediates their ubiquitination and subsequent degradation. Also mediates PARsylation of BLZF1 and CASC3, followed by recruitment of RNF146 and subsequent ubiquitination. Mediates PARsylation of TERF1, thereby contributing to the regulation of telomere length. Involved in centrosome maturation during prometaphase by mediating PARsylation of HEPACAM2/MIKI. May also regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. May be involved in spindle pole assembly through PARsylation of NUMA1.
Pathways Not Available
Reactions
NAD + (ADP-D-ribosyl)(n)-acceptor → Niacinamide + (ADP-D-ribosyl)(n+1)-acceptor details
GO Classification
Biological Process
mitotic spindle organization
peptidyl-serine phosphorylation
positive regulation of canonical Wnt receptor signaling pathway
positive regulation of telomere maintenance via telomerase
protein auto-ADP-ribosylation
protein localization to chromosome, telomeric region
protein polyubiquitination
cell division
mRNA transport
protein transport
Wnt receptor signaling pathway
spindle assembly
positive regulation of transcription from RNA polymerase II promoter
protein poly-ADP-ribosylation
peptidyl-threonine phosphorylation
negative regulation of DNA binding
mitosis
Cellular Component
pericentriolar material
nuclear pore
Golgi apparatus
chromosome, centromeric region
nuclear chromosome, telomeric region
nuclear membrane
spindle pole
Golgi membrane
Function
catalytic activity
transferase activity
nad+ adp-ribosyltransferase activity
transferase activity, transferring pentosyl groups
transferase activity, transferring glycosyl groups
Molecular Function
metal ion binding
NAD+ ADP-ribosyltransferase activity
zinc ion binding
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. Golgi apparatus membrane
  4. Peripheral membrane protein
  5. Chromosome
  6. Chromosome
  7. centromere
  8. telomere (Potential)
  9. nuclear pore complex
Gene Properties
Chromosome Location 8
Locus 8p23.1
SNPs TNKS
Gene Sequence
>3984 bp
ATGGCGGCGTCGCGTCGCTCTCAGCATCATCACCACCATCATCAACAACAGCTCCAGCCC
GCCCCAGGGGCTTCAGCGCCGCCGCCGCCACCTCCTCCCCCACTCAGCCCTGGCCTGGCC
CCGGGGACCACCCCAGCCTCTCCCACGGCCAGCGGCCTGGCCCCCTTCGCCTCCCCGCGG
CACGGCCTAGCGCTGCCGGAGGGGGATGGCAGTCGGGATCCGCCCGACAGGCCCCGATCC
CCGGACCCGGTTGACGGTACCAGCTGTTGCAGTACCACCAGCACAATCTGTACCGTCGCC
GCCGCTCCCGTGGTCCCAGCGGTTTCTACTTCATCTGCCGCTGGGGTCGCTCCCAACCCA
GCCGGCAGTGGCAGTAACAATTCACCGTCGTCCTCTTCTTCCCCGACTTCTTCCTCATCT
TCCTCTCCATCCTCCCCTGGATCGAGCTTGGCGGAGAGCCCCGAGGCGGCCGGAGTTAGC
AGCACAGCACCACTGGGGCCTGGGGCAGCAGGACCTGGGACAGGGGTCCCAGCAGTGAGC
GGGGCCCTACGGGAACTGCTGGAGGCCTGTCGCAATGGGGACGTGTCCCGGGTAAAGAGG
CTGGTGGACGCGGCAAACGTAAATGCAAAGGACATGGCCGGCCGGAAGTCTTCTCCCCTG
CACTTCGCTGCAGGTTTTGGAAGGAAGGATGTTGTAGAACACTTACTACAGATGGGTGCT
AATGTCCACGCTCGTGATGATGGAGGTCTCATCCCGCTTCATAATGCCTGTTCTTTTGGC
CATGCTGAGGTTGTGAGTCTGTTATTGTGCCAAGGAGCTGATCCAAATGCCAGGGATAAC
TGGAACTATACACCTCTGCATGAAGCTGCTATTAAAGGGAAGATCGATGTGTGCATTGTG
CTGCTGCAGCACGGAGCTGACCCAAACATTCGGAACACTGATGGGAAATCAGCCCTGGAC
CTGGCAGATCCTTCAGCAAAAGCTGTCCTTACAGGTGAATACAAGAAAGACGAACTCCTA
GAAGCTGCTAGGAGTGGTAATGAAGAAAAACTAATGGCTTTACTGACTCCTCTAAATGTG
AATTGCCATGCAAGTGATGGGCGAAAGTCGACTCCTTTACATCTAGCAGCGGGCTACAAC
AGAGTTCGAATAGTTCAGCTTCTTCTTCAGCATGGTGCTGATGTTCATGCAAAAGACAAA
GGTGGACTTGTGCCTCTTCATAATGCATGTTCATATGGACATTATGAAGTCACAGAACTG
CTACTAAAGCATGGAGCTTGTGTTAATGCCATGGATCTCTGGCAGTTTACTCCACTGCAC
GAGGCTGCTTCCAAGAACCGTGTAGAAGTCTGCTCTTTGTTACTTAGCCATGGCGCTGAT
CCTACATTAGTCAACTGCCATGGCAAAAGTGCTGTGGATATGGCTCCAACTCCGGAGCTT
AGGGAGAGATTGACTTATGAATTTAAAGGTCATTCTTTACTACAAGCAGCCAGAGAAGCA
GACTTAGCTAAAGTTAAAAAAACACTCGCTCTGGAAATCATTAATTTCAAACAACCGCAG
TCTCATGAAACAGCACTGCACTGTGCTGTGGCCTCTCTGCATCCCAAACGTAAACAAGTG
ACAGAATTGTTACTTAGAAAAGGAGCAAATGTTAATGAAAAAAATAAAGATTTCATGACT
CCCCTGCATGTTGCAGCCGAAAGAGCCCATAATGATGTCATGGAAGTTCTGCATAAGCAT
GGCGCCAAGATGAATGCACTGGACACCCTTGGTCAGACTGCTTTGCATAGAGCCGCCCTA
GCAGGCCACCTGCAGACCTGCCGCCTCCTGCTGAGTTACGGCTCTGACCCCTCCATCATC
TCCTTACAAGGCTTCACAGCAGCACAGATGGGCAATGAAGCAGTGCAGCAGATTCTGAGT
GAGAGTACACCTATACGTACTTCTGATGTTGATTATCGACTCTTAGAGGCATCTAAAGCT
GGAGACTTGGAAACTGTGAAGCAACTTTGCAGCTCTCAAAATGTGAATTGTAGAGACTTA
GAGGGCCGGCATTCCACGCCCTTACACTTCGCAGCAGGCTACAACCGCGTGTCTGTTGTA
GAGTACCTGCTACACCACGGTGCCGATGTCCATGCCAAAGACAAGGGTGGCTTGGTGCCC
CTTCATAATGCCTGTTCATATGGACACTATGAGGTGGCTGAGCTTTTAGTAAGGCATGGG
GCTTCTGTCAATGTGGCGGACTTATGGAAATTTACCCCTCTCCATGAAGCAGCAGCTAAA
GGAAAGTATGAAATCTGCAAGCTCCTTTTAAAACATGGAGCAGATCCAACTAAAAAGAAC
AGAGATGGAAATACACCTTTGGATTTGGTAAAGGAAGGAGACACAGATATTCAGGACTTA
CTGAGAGGGGATGCTGCTTTGTTGGATGCTGCCAAGAAGGGCTGCCTGGCAAGAGTGCAG
AAGCTCTGTACCCCAGAGAATATCAACTGCAGAGACACCCAGGGCAGAAATTCAACCCCT
CTGCACCTGGCAGCAGGCTATAATAACCTGGAAGTAGCTGAATATCTTCTAGAGCATGGA
GCTGATGTTAATGCCCAGGACAAGGGTGGTTTAATTCCTCTTCATAATGCGGCATCTTAT
GGGCATGTTGACATAGCGGCTTTATTGATAAAATACAACACGTGTGTAAATGCAACAGAT
AAGTGGGCGTTTACTCCCCTCCATGAAGCAGCCCAGAAAGGAAGGACGCAGCTGTGCGCC
CTCCTCCTAGCGCATGGTGCAGACCCCACCATGAAGAACCAGGAAGGCCAGACGCCTCTG
GATCTGGCAACAGCTGACGATATCAGAGCTTTGCTGATAGATGCCATGCCCCCAGAGGCC
TTACCTACCTGTTTTAAACCTCAGGCTACTGTAGTGAGTGCCTCTCTGATCTCACCAGCA
TCCACCCCCTCCTGCCTCTCGGCTGCCAGCAGCATAGACAACCTCACTGGCCCTTTAGCA
GAGTTGGCCGTAGGAGGAGCCTCCAATGCAGGGGATGGCGCCGCGGGAACAGAAAGGAAG
GAAGGAGAAGTTGCTGGTCTTGACATGAATATCAGCCAATTTCTAAAAAGCCTTGGCCTT
GAACACCTTCGGGATATCTTTGAAACAGAACAGATTACACTAGATGTGTTGGCTGATATG
GGTCATGAAGAGTTGAAAGAAATAGGCATCAATGCATATGGGCACCGCCACAAATTAATC
AAAGGAGTAGAAAGACTCTTAGGTGGACAACAAGGCACCAATCCTTATTTGACTTTTCAC
TGTGTTAATCAGGGAACGATTTTGCTGGATCTTGCTCCAGAAGATAAAGAATATCAGTCA
GTGGAAGAAGAGATGCAAAGTACTATTCGAGAACACAGAGATGGTGGTAATGCTGGCGGC
ATCTTCAACAGATACAATGTCATTCGAATTCAAAAAGTTGTCAACAAGAAGTTGAGGGAG
CGGTTCTGCCACCGACAGAAGGAAGTGTCTGAGGAGAATCACAACCATCACAATGAGCGC
ATGTTGTTTCATGGTTCTCCTTTCATTAATGCCATTATTCATAAAGGGTTTGATGAGCGA
CATGCATACATAGGAGGAATGTTTGGGGCCGGGATTTATTTTGCTGAAAACTCCTCAAAA
AGCAACCAATATGTTTATGGAATTGGAGGAGGAACAGGCTGCCCTACACACAAGGACAGG
TCATGCTATATATGTCACAGACAAATGCTCTTCTGTAGAGTGACCCTTGGGAAATCCTTT
CTGCAGTTTAGCACCATGAAAATGGCCCACGCGCCTCCAGGGCACCACTCAGTCATTGGT
AGACCGAGCGTCAATGGGCTGGCATATGCTGAATATGTCATCTACAGAGGAGAACAGGCA
TACCCAGAGTATCTTATCACTTACCAGATCATGAAGCCAGAAGCCCCTTCCCAGACCGCA
ACAGCCGCAGAGCAGAAGACCTAG
Protein Properties
Number of Residues 1327
Molecular Weight 142038.18
Theoretical pI 7.05
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Tankyrase-1
MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTASGLAPFASPR
HGLALPEGDGSRDPPDRPRSPDPVDGTSCCSTTSTICTVAAAPVVPAVSTSSAAGVAPNP
AGSGSNNSPSSSSSPTSSSSSSPSSPGSSLAESPEAAGVSSTAPLGPGAAGPGTGVPAVS
GALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGA
NVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIV
LLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNV
NCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTEL
LLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPEL
RERLTYEFKGHSLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQV
TELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHRAAL
AGHLQTCRLLLSYGSDPSIISLQGFTAAQMGNEAVQQILSESTPIRTSDVDYRLLEASKA
GDLETVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVP
LHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKN
RDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTP
LHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATD
KWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLIDAMPPEA
LPTCFKPQATVVSASLISPASTPSCLSAASSIDNLTGPLAELAVGGASNAGDGAAGTERK
EGEVAGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLI
KGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGG
IFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDER
HAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSF
LQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEAPSQTA
TAAEQKT
GenBank ID Protein 87239981
UniProtKB/Swiss-Prot ID O95271
UniProtKB/Swiss-Prot Entry Name TNKS1_HUMAN
PDB IDs
GenBank Gene ID NM_003747.2
GeneCard ID TNKS
GenAtlas ID TNKS
HGNC ID HGNC:11941
References
General References
  1. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  2. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. [PubMed:16421571 ]
  3. Cook BD, Dynek JN, Chang W, Shostak G, Smith S: Role for the related poly(ADP-Ribose) polymerases tankyrase 1 and 2 at human telomeres. Mol Cell Biol. 2002 Jan;22(1):332-42. [PubMed:11739745 ]
  4. Smith S, Giriat I, Schmitt A, de Lange T: Tankyrase, a poly(ADP-ribose) polymerase at human telomeres. Science. 1998 Nov 20;282(5393):1484-7. [PubMed:9822378 ]
  5. Smith S, de Lange T: Cell cycle dependent localization of the telomeric PARP, tankyrase, to nuclear pore complexes and centrosomes. J Cell Sci. 1999 Nov;112 ( Pt 21):3649-56. [PubMed:10523501 ]
  6. Chi NW, Lodish HF: Tankyrase is a golgi-associated mitogen-activated protein kinase substrate that interacts with IRAP in GLUT4 vesicles. J Biol Chem. 2000 Dec 8;275(49):38437-44. [PubMed:10988299 ]
  7. Loayza D, De Lange T: POT1 as a terminal transducer of TRF1 telomere length control. Nature. 2003 Jun 26;423(6943):1013-8. Epub 2003 May 25. [PubMed:12768206 ]