You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00917
Secondary Accession Numbers
  • 6205
Name NAD kinase
Synonyms
  1. Poly(P)/ATP NAD kinase
Gene Name NADK
Protein Type Unknown
Biological Properties
General Function Involved in NAD+ kinase activity
Specific Function Not Available
Pathways
  • Nicotinate and Nicotinamide Metabolism
  • Nicotinate and nicotinamide metabolism
Reactions
Adenosine triphosphate + NAD → ADP + NADP details
GO Classification
Biological Process
ATP metabolic process
NADP biosynthetic process
water-soluble vitamin metabolic process
NAD metabolic process
Cellular Component
cytosol
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nad+ kinase activity
Molecular Function
metal ion binding
NAD+ kinase activity
ATP binding
Process
metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p36.33
SNPs NADK
Gene Sequence
>1341 bp
ATGGAAATGGAACAAGAAAAAATGACCATGAATAAGGAATTGAGTCCAGACGCGGCTGCT
TACTGCTGCTCGGCCTGCCACGGCGATGAGACCTGGAGTTACAACCACCCCATCCGGGGC
CGGGCCAAGTCTCGCAGCCTGTCTGCCTCGCCCGCCCTGGGGAGCACCAAGGAGTTCAGG
AGGACACGCTCTCTTCATGGGCCATGCCCGGTGACCACTTTTGGACCAAAGGCCTGTGTG
CTGCAGAACCCCCAGACCATCATGCACATTCAGGACCCCGCGAGCCAGCGGCTGACGTGG
AACAAGTCCCCAAAGAGCGTCCTTGTCATCAAGAAGATGAGAGATGCCAGCCTACTGCAG
CCGTTCAAGGAGCTCTGCACGCACCTCATGGAGGAGAACATGATCGTGTATGTGGAAAAG
AAAGTGCTAGAAGACCCTGCCATCGCCAGCGATGAAAGCTTTGGGGCAGTGAAGAAGAAA
TTCTGTACCTTTCGAGAAGATTATGATGACATTTCCAATCAGATAGACTTCATCATCTGC
CTGGGGGGAGACGGGACGCTGCTGTACGCTTCCTCGCTTTTCCAGGGCAGCGTCCCTCCG
GTCATGGCCTTCCACCTGGGCTCCCTGGGCTTCCTGACCCCATTCAGCTTTGAGAACTTT
CAGTCCCAAGTTACTCAGGTGATAGAGGGGAACGCAGCTGTTGTTCTCCGGAGTCGGCTG
AAGGTCAGGGTGGTGAAGGAGCTCCGGGGGAAGAAGACGGCCGTGCACAATGGGCTGGGT
GAGAACGGCTCGCAGGCTGCAGGCCTGGACATGGATGTCGGGAAGCAGGCCATGCAGTAC
CAGGTCCTGAATGAGGTGGTGATTGACAGAGGCCCCTCCTCCTACCTGTCCAATGTGGAT
GTCTACCTGGACGGACACCTCATCACCACGGTGCAGGGCGACGGAGTGATCGTGTCCACC
CCGACGGGCAGCACGGCGTATGCGGCCGCGGCCGGGGCCTCCATGATCCACCCCAACGTG
CCGGCCATCATGATCACGCCCATCTGCCCCCACTCGCTGTCCTTCCGGCCCATCGTGGTC
CCCGCAGGGGTCGAGCTGAAGATCATGCTGTCACCTGAAGCAAGGAACACAGCATGGGTG
TCCTTTGATGGACGGAAGAGACAAGAGATCCGCCATGGAGACAGCATCAGCATCACTACC
TCATGCTACCCGCTCCCCTCCATCTGTGTGCGGGACCCCGTGAGCGACTGGTTTGAGAGC
CTCGCCCAGTGCCTGCATTGGAACGTCCGGAAGAAGCAAGCCCACTTCGAGGAGGAGGAG
GAGGAGGAGGAGGAGGGCTAG
Protein Properties
Number of Residues 446
Molecular Weight 49227.815
Theoretical pI 6.472
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>NAD kinase
MEMEQEKMTMNKELSPDAAAYCCSACHGDETWSYNHPIRGRAKSRSLSASPALGSTKEFR
RTRSLHGPCPVTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSVLVIKKMRDASLLQ
PFKELCTHLMEENMIVYVEKKVLEDPAIASDESFGAVKKKFCTFREDYDDISNQIDFIIC
LGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFSFENFQSQVTQVIEGNAAVVLRSRL
KVRVVKELRGKKTAVHNGLGENGSQAAGLDMDVGKQAMQYQVLNEVVIDRGPSSYLSNVD
VYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVV
PAGVELKIMLSPEARNTAWVSFDGRKRQEIRHGDSISITTSCYPLPSICVRDPVSDWFES
LAQCLHWNVRKKQAHFEEEEEEEEEG
GenBank ID Protein 312222779
UniProtKB/Swiss-Prot ID O95544
UniProtKB/Swiss-Prot Entry Name NADK_HUMAN
PDB IDs
GenBank Gene ID NM_001198993.1
GeneCard ID NADK
GenAtlas ID NADK
HGNC ID HGNC:29831
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  6. Lerner F, Niere M, Ludwig A, Ziegler M: Structural and functional characterization of human NAD kinase. Biochem Biophys Res Commun. 2001 Oct 19;288(1):69-74. [PubMed:11594753 ]