You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00963
Secondary Accession Numbers
  • 6251
Name DNA polymerase subunit alpha B
Synonyms
  1. DNA polymerase alpha 70 kDa subunit
Gene Name POLA2
Protein Type Enzyme
Biological Properties
General Function Not Available
Specific Function May play an essential role at the early stage of chromosomal DNA replication by coupling the polymerase alpha/primase complex to the cellular replication machinery
Pathways Not Available
Reactions Not Available
GO Classification
Component
organelle
nucleus
membrane-bound organelle
intracellular membrane-bound organelle
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleotidyltransferase activity
dna-directed dna polymerase activity
nucleic acid binding
dna binding
Process
cellular metabolism
nucleobase, nucleoside, nucleotide and nucleic acid metabolism
dna replication
dna metabolism
physiological process
metabolism
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:11
Locus 11q13.1
SNPs POLA2
Gene Sequence
>1797 bp
ATGTCCGCATCCGCCCAGCAGCTGGCGGAGGAGCTGCAGATCTTCGGCCTAGACTGCGAG
GAGGCTCTAATTGAGAAATTGGTAGAGCTTTGTGTTCAGTATGGACAGAATGAGGAGGGA
ATGGTAGGCGAGCTTATAGCCTTCTGCACCAGCACACATAAAGTTGGCCTTACCTCAGAG
ATCCTGAACTCTTTTGAGCATGAGTTTCTGAGCAAAAGATTATCGAAAGCCAGGCATAGT
ACCTGCAAGGACAGTGGCCATGCAGGAGCTAGAGACATTGTTTCCATTCAAGAGCTAATT
GAAGTGGAAGAAGAAGAGGAAATCCTCTTGAACTCTTACACCACACCTTCAAAGGGTTCT
CAGAAGCGAGCTATCTCTACCCCAGAAACCCCCCTAACAAAAAGGAGTGTGTCAACTCGT
AGCCCCCATCAGCTACTCTCACCGTCAAGTTTCTCTCCAAGTGCTACTCCCTCCCAGAAA
TACAACTCACGAAGTAACCGAGGAGAAGTGGTTACCTCCTTCGGCTTAGCACAGGGAGTA
TCTTGGTCTGGGAGAGGAGGAGCTGGAAACATCAGCCTGAAGGTCTTGGGATGTCCAGAG
GCACTAACTGGGAGCTACAAATCCATGTTTCAGAAGCTCCCAGACATTCGAGAAGTTCTG
ACCTGTAAGATAGAAGAACTTGGCAGCGAACTCAAGGAACATTACAAGATTGAAGCTTTC
ACTCCTTTGCTAGCCCCAGCACAGGAGCCTGTCACTCTGCTGGGCCAGATTGGCTGTGAT
AGCAACGGGAAGCTGAACAACAAGTCAGTGATTCTCGAGGGAGACCGGGAACATTCCTCG
GGTGCTCAAATTCCAGTGGATTTATCTGAGCTTAAGGAATATTCTCTGTTTCCTGGACAG
GTTGTAATTATGGAAGGAATCAACACCACTGGTAGGAAACTTGTTGCCACCAAACTCTAC
GAGGGTGTGCCACTTCCATTTTATCAGCCCACTGAAGAGGATGCAGACTTTGAGCAAAGC
ATGGTCCTGGTTGCCTGTGGACCATACACCACATCTGACAGCATCACGTATGACCCCCTG
CTTGACCTGATTGCTGTCATCAACCATGACCGGCCAGATGTCTGCATCCTGTTTGGCCCT
TTCCTGGAGTCTAAGCATGAACAGGTGGAGAATTGTCTACTGACAAGTCCATTTGAAGAC
ATTTTCAAGCAGTGTCTACGAACAATTATTGAAGGCACAAGAAGCTCCGGCTCCCACCTT
GTCTTTGTCCCGTCATTGAGAGATGTGCACCATGAGCCTGTGTACCCCCAGCCGCCTTTC
AGCTACTCCGATCTGTCTCGAGAGGACAAAAAGCAAGTACAGTTTGTGTCCGAGCCCTGC
AGCCTCTCCATAAACGGAGTGATCTTCGGCTTGACATCCACAGATCTGCTTTTCCACCTG
GGGGCCGAGGAGATCAGTAGTTCTTCCGGAACTTCAGACAGATTCAGCCGAATACTCAAG
CACATCTTGACCCAGAGGAGCTACTACCCACTCTACCCGCCCCAAGAAGACATGGCCATT
GACTATGAGTCGTTCTATGTTTACGCACAGCTGCCTGTCACCCCAGATGTCCTCATCATC
CCGTCAGAGCTGAGGTACTTCGTGAAGGATGTCCTCGGCTGTGTCTGTGTGAACCCTGGG
CGCCTTACCAAAGGGCAGGTGGGAGGCACCTTCGCCCGACTCTACCTTAGGAGGCCGGCA
GCGGACGGGGCAGAGAGGCAGAGCCCATGCATTGCTGTGCAGGTCGTCAGGATCTGA
Protein Properties
Number of Residues 598
Molecular Weight 65948.0
Theoretical pI 4.9
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>DNA polymerase subunit alpha B
MSASAQQLAEELQIFGLDCEEALIEKLVELCVQYGQNEEGMVGELIAFCTSTHKVGLTSE
ILNSFEHEFLSKRLSKARHSTCKDSGHAGARDIVSIQELIEVEEEEEILLNSYTTPSKGS
QKRAISTPETPLTKRSVSTRSPHQLLSPSSFSPSATPSQKYNSRSNRGEVVTSFGLAQGV
SWSGRGGAGNISLKVLGCPEALTGSYKSMFQKLPDIREVLTCKIEELGSELKEHYKIEAF
TPLLAPAQEPVTLLGQIGCDSNGKLNNKSVILEGDREHSSGAQIPVDLSELKEYSLFPGQ
VVIMEGINTTGRKLVATKLYEGVPLPFYQPTEEDADFEQSMVLVACGPYTTSDSITYDPL
LDLIAVINHDRPDVCILFGPFLDAKHEQVENCLLTSPFEDIFKQCLRTIIEGTRSSGSHL
VFVPSLRDVHHEPVYPQPPFSYSDLSREDKKQVQFVSEPCSLSINGVIFGLTSTDLLFHL
GAEEISSSSGTSDRFSRILKHILTQRSYYPLYPPQEDMAIDYESFYVYAQLPVTPDVLII
PSELRYFVKDVLGCVCVNPGRLTKGQVGGTFARLYLRRPAADGAERQSPCIAVQVVRI
GenBank ID Protein 439601
UniProtKB/Swiss-Prot ID Q14181
UniProtKB/Swiss-Prot Entry Name DPOA2_HUMAN
PDB IDs Not Available
GenBank Gene ID L24559
GeneCard ID POLA2
GenAtlas ID POLA2
HGNC ID HGNC:30073
References
General References
  1. Collins KL, Russo AA, Tseng BY, Kelly TJ: The role of the 70 kDa subunit of human DNA polymerase alpha in DNA replication. EMBO J. 1993 Dec;12(12):4555-66. [PubMed:8223465 ]
  2. Nasheuer HP, Moore A, Wahl AF, Wang TS: Cell cycle-dependent phosphorylation of human DNA polymerase alpha. J Biol Chem. 1991 Apr 25;266(12):7893-903. [PubMed:1902230 ]