You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00974
Secondary Accession Numbers
  • 6262
Name Arachidonate 12-lipoxygenase, 12S-type
Synonyms
  1. 12S-LOX
  2. 12S-lipoxygenase
  3. Platelet-type lipoxygenase 12
Gene Name ALOX12
Protein Type Unknown
Biological Properties
General Function Involved in metal ion binding
Specific Function Oxygenase and 14,15-leukotriene A4 synthase activity.
Pathways
  • Acetaminophen Action Pathway
  • Acetylsalicylic Acid Action Pathway
  • Antipyrine Action Pathway
  • Antrafenine Action Pathway
  • Arachidonic acid metabolism
  • Arachidonic Acid Metabolism
  • Bromfenac Action Pathway
  • Carprofen Action Pathway
  • Celecoxib Action Pathway
  • Diclofenac Action Pathway
  • Diflunisal Action Pathway
  • Etodolac Action Pathway
  • Etoricoxib Action Pathway
  • Fenoprofen Action Pathway
  • Flurbiprofen Action Pathway
  • Ibuprofen Action Pathway
  • Indomethacin Action Pathway
  • Ketoprofen Action Pathway
  • Ketorolac Action Pathway
  • Leukotriene C4 Synthesis Deficiency
  • leukotriene D4 biosynthesis
  • Lornoxicam Action Pathway
  • Lumiracoxib Action Pathway
  • Magnesium salicylate Action Pathway
  • Mefenamic Acid Action Pathway
  • Meloxicam Action Pathway
  • Nabumetone Action Pathway
  • Naproxen Action Pathway
  • Nepafenac Action Pathway
  • Oxaprozin Action Pathway
  • Phenylbutazone Action Pathway
  • Piroxicam Action Pathway
  • Rofecoxib Action Pathway
  • Salicylate-sodium Action Pathway
  • Salicylic Acid Action Pathway
  • Salsalate Action Pathway
  • Serotonergic synapse
  • Sulindac Action Pathway
  • Suprofen Action Pathway
  • Tenoxicam Action Pathway
  • Tiaprofenic Acid Action Pathway
  • Tolmetin Action Pathway
  • Trisalicylate-choline Action Pathway
  • Valdecoxib Action Pathway
Reactions
Arachidonic acid + Oxygen → 12(S)-HPETE details
GO Classification
Biological Process
positive regulation of apoptotic process
positive regulation of cell proliferation
negative regulation of apoptotic process
positive regulation of cell adhesion
cellular component movement
negative regulation of cell killing
positive regulation of cell killing
positive regulation of endothelial cell differentiation
positive regulation of endothelial cell migration
positive regulation of mitochondrial depolarization
positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
fatty acid oxidation
positive regulation of cell growth
superoxide anion generation
leukotriene biosynthetic process
positive regulation of gene expression
Cellular Component
cytosol
sarcolemma
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
transition metal ion binding
iron ion binding
lipoxygenase activity
oxidoreductase activity
Molecular Function
arachidonate 12-lipoxygenase activity
hepoxilin-epoxide hydrolase activity
lipoxygenase activity
iron ion binding
Process
metabolic process
cellular metabolic process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
monocarboxylic acid metabolic process
fatty acid metabolic process
oxidation reduction
unsaturated fatty acid metabolic process
icosanoid metabolic process
leukotriene metabolic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 17
Locus 17p13.1
SNPs ALOX12
Gene Sequence
>1992 bp
ATGGGCCGCTACCGCATCCGCGTGGCCACCGGGGCCTGGCTCTTCTCCGGGTCGTACAAC
CGCGTGCAGCTTTGGCTGGTCGGGACGCGCGGGGAGGCGGAGCTGGAGCTGCAGCTGCGG
CCGGCGCGGGGCGAGGAGGAGGAGTTTGATCATGACGTTGCAGAGGACTTGGGGCTCCTG
CAGTTCGTGAGGCTGCGCAAGCACCACTGGCTGGTGGACGACGCGTGGTTCTGCGACCGC
ATCACGGTGCAGGGCCCTGGAGCCTGCGCGGAGGTGGCCTTCCCGTGCTACCGCTGGGTG
CAGGGCGAGGACATCCTGAGCCTGCCCGAGGGCACCGCCCGCCTGCCAGGAGACAATGCT
TTGGACATGTTCCAGAAGCATCGAGAGAAGGAACTGAAAGACAGACAGCAGATCTACTGC
TGGGCCACCTGGAAGGAAGGGTTACCCCTGACCATCGCTGCAGACCGTAAGGATGATCTA
CCTCCAAATATGAGATTCCATGAGGAGAAGAGGCTGGACTTTGAATGGACACTGAAGGCA
GGGGCTCTGGAGATGGCCCTCAAACGTGTTTACACCCTCCTGAGCTCCTGGAACTGCCTA
GAAGACTTTGATCAGATCTTCTGGGGCCAGAAGAGTGCCCTGGCTGAGAAGGTTCGCCAG
TGCTGGCAGGATGATGAGTTGTTCAGCTACCAGTTCCTCAATGGTGCCAACCCCATGCTG
TTGAGACGCTCGACCTCTCTGCCCTCCAGGCTAGTGCTGCCCTCGGGGATGGAAGAGCTT
CAGGCTCAACTGGAGAAAGAACTTCAGAATGGTTCCCTGTTTGAAGCTGACTTCATCCTT
CTGGATGGAATTCCAGCCAACGTGATCCGAGGAGAGAAGCAATACCTGGCTGCCCCCCTC
GTTATGCTGAAGATGGAGCCCAATGGGAAGCTGCAGCCCATGGTCATCCAGATTCAGCCT
CCCAGCCCCAGCTCTCCAACCCCAACACTGTTCCTGCCCTCAGACCCCCCACTTGCCTGG
CTCCTGGCAAAGTCCTGGGTCCGAAATTCAGATTTCCAACTGCACGAGATCCAGTATCAC
TTGCTGAACACTCACCTGGTGGCTGAGGTCATCGCTGTCGCCACCATGCGGTGCCTCCCA
GGACTGCACCCCATCTTCAAGTTCCCGATCCCCCATATCCGCTACACCATGGAAATCAAC
ACCCGGGCCCGGACCCAACTCATCTCAGATGGAGGAATTTTTGATAAGGCAGTGAGCACA
GGTGGAGGGGGCCATGTACAGTTGCTCCGTCGGGCGGCAGCTCAGCTGACCTACTGCTCC
CTCTGTCCTCCTGACGACCTGGCTGACCGGGGCCTGCTGGGACTCCCAGGTGCTCTCTAT
GCCCATGATGCTTTACGGCTCTGGGAGATCATTGCCAGGTATGTGGAGGGGATCGTCCAC
CTCTTCTACCAAAGGGATGACATAGTGAAGGGGGACCCTGAGCTGCAGGCCTGGTGTCGG
GAGATCACGGAGGTGGGGCTGTGCCAGGCCCAGGACCGAGGTTTCCCTGTCTCCTTCCAG
TCCCAGAGTCAACTCTGCCATTTCCTCACCATGTGCGTCTTCACGTGCACTGCCCAGCAT
GCCGCCATCAACCAGGGCCAGCTGGACTGGTATGCCTGGGTCCCTAATGCTCCATGCACA
ATGCGGATGCCCCCACCCACCACCAAGGAAGATGTGACGATGGCCACAGTGATGGGGTCA
CTACCTGATGTCCGGCAGGCCTGTCTTCAAATGGCCATCTCATGGCATCTGAGTCGCCGC
CAGCCAGACATGGTGCCTCTGGGGCACCACAAAGAAAAATATTTCTCAGGCCCCAAGCCC
AAAGCTGTGCTAAACCAATTCCGAACAGATTTGGAAAAGCTAGAAAAGGAGATTACAGCC
CGGAATGAGCAACTTGACTGGCCCTATGAATATCTGAAGCCCAGCTGCATAGAGAACAGT
GTCACCATCTGA
Protein Properties
Number of Residues 663
Molecular Weight 75693.38
Theoretical pI 6.213
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Arachidonate 12-lipoxygenase, 12S-type
MGRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLRPARGEEEEFDHDVAEDLGLL
QFVRLRKHHWLVDDAWFCDRITVQGPGACAEVAFPCYRWVQGEDILSLPEGTARLPGDNA
LDMFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKA
GALEMALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPML
LRRSTSLPSRLVLPSGMEELQAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPL
VMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYH
LLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVST
GGGGHVQLLRRAAAQLTYCSLCPPDDLADRGLLGLPGALYAHDALRLWEIIARYVEGIVH
LFYQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQH
AAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRR
QPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENS
VTI
GenBank ID Protein 189774
UniProtKB/Swiss-Prot ID P18054
UniProtKB/Swiss-Prot Entry Name LOX12_HUMAN
PDB IDs
GenBank Gene ID M35418
GeneCard ID ALOX12
GenAtlas ID ALOX12
HGNC ID HGNC:429
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Goodman JE, Bowman ED, Chanock SJ, Alberg AJ, Harris CC: Arachidonate lipoxygenase (ALOX) and cyclooxygenase (COX) polymorphisms and colon cancer risk. Carcinogenesis. 2004 Dec;25(12):2467-72. Epub 2004 Aug 12. [PubMed:15308583 ]
  3. Funk CD, Furci L, FitzGerald GA: Molecular cloning, primary structure, and expression of the human platelet/erythroleukemia cell 12-lipoxygenase. Proc Natl Acad Sci U S A. 1990 Aug;87(15):5638-42. [PubMed:2377602 ]
  4. Izumi T, Hoshiko S, Radmark O, Samuelsson B: Cloning of the cDNA for human 12-lipoxygenase. Proc Natl Acad Sci U S A. 1990 Oct;87(19):7477-81. [PubMed:2217179 ]
  5. Yoshimoto T, Yamamoto Y, Arakawa T, Suzuki H, Yamamoto S, Yokoyama C, Tanabe T, Toh H: Molecular cloning and expression of human arachidonate 12-lipoxygenase. Biochem Biophys Res Commun. 1990 Nov 15;172(3):1230-5. [PubMed:2244907 ]
  6. Yoshimoto T, Arakawa T, Hada T, Yamamoto S, Takahashi E: Structure and chromosomal localization of human arachidonate 12-lipoxygenase gene. J Biol Chem. 1992 Dec 5;267(34):24805-9. [PubMed:1447217 ]
  7. Funk CD, Funk LB, FitzGerald GA, Samuelsson B: Characterization of human 12-lipoxygenase genes. Proc Natl Acad Sci U S A. 1992 May 1;89(9):3962-6. [PubMed:1570320 ]
  8. Hussain H, Shornick LP, Shannon VR, Wilson JD, Funk CD, Pentland AP, Holtzman MJ: Epidermis contains platelet-type 12-lipoxygenase that is overexpressed in germinal layer keratinocytes in psoriasis. Am J Physiol. 1994 Jan;266(1 Pt 1):C243-53. [PubMed:8304420 ]