Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00981
Secondary Accession Numbers
  • 6269
Name Dolichyl-phosphate beta-glucosyltransferase
Synonyms
  1. Asparagine-linked glycosylation protein 5 homolog
  2. DolP-glucosyltransferase
Gene Name ALG5
Protein Type Enzyme
Biological Properties
General Function Cell wall/membrane/envelope biogenesis
Specific Function Not Available
Pathways
  • N-Glycan biosynthesis
  • protein glycosylation
Reactions
Uridine diphosphate glucose + Dolichol-20 → Uridine 5'-diphosphate + Dolichyl b-D-glucosyl phosphate details
GO Classification
Biological Process
determination of left/right symmetry
dolichol-linked oligosaccharide biosynthetic process
post-translational protein modification
protein N-linked glycosylation via asparagine
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Molecular Function
dolichyl-phosphate beta-glucosyltransferase activity
oligosaccharyl transferase activity
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 13
Locus 13q13.3
SNPs ALG5
Gene Sequence
>975 bp
ATGGCTCCGCTTCTGTTGCAGCTGGCGGTGCTCGGCGCGGCGCTGGCGGCCGCAGCCCTC
GTACTGATTTCCATCGTTGCATTTACAACTGCTACAAAAATGCCAGCACTCCATCGACAT
GAAGAAGAGAAATTCTTCTTAAATGCCAAAGGCCAGAAAGAAACTTTACCCAGCATATGG
GACTCACCTACCAAACAACTTTCTGTCGTTGTGCCTTCATACAATGAAGAAAAACGGTTG
CCTGTGATGATGGATGAAGCTCTGAGCTATCTAGAGAAGAGACAGAAACGAGATCCTGCG
TTCACTTATGAAGTGATAGTAGTTGATGATGGCAGTAAAGATCAGACCTCAAAGGTAGCT
TTTAAATATTGCCAGAAATATGGAAGTGACAAAGTACGTGTGATAACCCTGGTGAAGAAT
CGTGGAAAAGGTGGAGCGATTAGAATGGGTATATTCAGTTCTCGAGGAGAAAAGATCCTT
ATGGCAGATGCTGATGGAGCCACAAAGTTTCCAGATGTTGAGAAATTAGAAAAGGGGCTA
AATGATCTACAGCCTTGGCCTAATCAAATGGCTATAGCATGTGGATCTCGAGCTCATTTA
GAAAAAGAATCAATTGCTCAGCGTTCTTACTTCCGTACTCTTCTCATGTATGGGTTCCAC
TTTCTGGTGTGGTTCCTTTGTGTCAAAGGAATCAGGGACACACAGTGTGGGTTCAAATTA
TTTACTCGAGAAGCAGCTTCACGGACGTTTTCATCTCTACACGTTGAACGATGGGCATTT
GATGTAGAACTACTGTACATAGCACAGTTCTTTAAAATTCCAATAGCAGAAATTGCTGTC
AACTGGACAGAAATTGAAGGTTCTAAATTAGTTCCATTCTGGAGCTGGCTACAAATGGGT
AAAGACCTACTTTTTATACGACTTCGATATTTGACTGGTGCCTGGAGGCTTGAGCAAACT
CGGAAAATGAATTAG
Protein Properties
Number of Residues 324
Molecular Weight 33524.965
Theoretical pI 9.443
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Dolichyl-phosphate beta-glucosyltransferase
MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIW
DSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVA
FKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGL
NDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKL
FTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMG
KDLLFIRLRYLTGAWRLEQTRKMN
GenBank ID Protein 5281121
UniProtKB/Swiss-Prot ID Q9Y673
UniProtKB/Swiss-Prot Entry Name ALG5_HUMAN
PDB IDs Not Available
GenBank Gene ID AF102850
GeneCard ID ALG5
GenAtlas ID ALG5
HGNC ID HGNC:20266
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Zhang QH, Ye M, Wu XY, Ren SX, Zhao M, Zhao CJ, Fu G, Shen Y, Fan HY, Lu G, Zhong M, Xu XR, Han ZG, Zhang JW, Tao J, Huang QH, Zhou J, Hu GX, Gu J, Chen SJ, Chen Z: Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells. Genome Res. 2000 Oct;10(10):1546-60. [PubMed:11042152 ]
  3. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823 ]
  4. Imbach T, Burda P, Kuhnert P, Wevers RA, Aebi M, Berger EG, Hennet T: A mutation in the human ortholog of the Saccharomyces cerevisiae ALG6 gene causes carbohydrate-deficient glycoprotein syndrome type-Ic. Proc Natl Acad Sci U S A. 1999 Jun 8;96(12):6982-7. [PubMed:10359825 ]