Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00984
Secondary Accession Numbers
  • 6272
Name Inositol-trisphosphate 3-kinase A
Synonyms
  1. IP3 3-kinase A
  2. IP3K A
  3. Inositol 1,4,5-trisphosphate 3-kinase A
  4. InsP 3-kinase A
Gene Name ITPKA
Protein Type Enzyme
Biological Properties
General Function Involved in inositol trisphosphate 3-kinase activity
Specific Function Not Available
Pathways
  • Calcium signaling pathway
  • Inositol Metabolism
  • Inositol phosphate metabolism
  • Inositol Phosphate Metabolism
  • Phosphatidylinositol signaling system
Reactions
Adenosine triphosphate + myo-Inositol 1,4,5-trisphosphate → ADP + myo-Inositol 1,3,4,5-tetrakisphosphate details
GO Classification
Biological Process
signal transduction
inositol metabolic process
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
inositol or phosphatidylinositol kinase activity
inositol trisphosphate kinase activity
inositol trisphosphate 3-kinase activity
Molecular Function
ATP binding
calmodulin-dependent protein kinase activity
inositol-1,4,5-trisphosphate 3-kinase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 15
Locus 15q15.1
SNPs ITPKA
Gene Sequence
>1386 bp
ATGACCCTGCCCGGGGGCCCAACGGGCATGGCGCGGCCGGGGGGCGCGAGGCCCTGCAGC
CCGGGGCTGGAGCGGGCCCCGCGCCGGAGTGTCGGGGAGCTGCGCCTGCTCTTCGAGGCG
CGCTGTGCGGCGGTCGCTGCGGCCGCCGCCGCGGGGGAGCCCCGGGCCCGCGGGGCCAAG
CGGCGTGGGGGACAGGTCCCCAACGGGCTTCCGCGGGCTCCCCCGGCCCCGGTGATCCCT
CAGCTGACCGTGACAGCCGAGGAGCCCGACGTGCCCCCGACCAGCCCTGGGCCGCCGGAG
CGGGAGAGGGACTGCCTCCCGGCAGCGGGCTCTTCGCACCTGCAGCAGCCGCGCCGCCTT
TCCACCTCGTCGGTCTCCTCCACTGGCTCCTCGTCGCTGCTCGAGGACTCGGAGGACGAC
CTGCTGAGCGACAGTGAGAGCCGGAGCCGCGGCAACGTGCAGCTGGAAGCGGGCGAGGAC
GTGGGTCAGAAAAACCACTGGCAGAAGATCCGGACCATGGTCAATCTGCCGGTCATAAGC
CCTTTCAAGAAGCGCTACGCCTGGGTGCAGCTGGCAGGGCACACTGGGAGTTTTAAGGCG
GCGGGCACCAGCGGGCTGATCCTGAAGCGCTGCTCGGAGCCGGAGCGCTACTGCCTGGCG
CGGCTGATGGCTGACGCGCTGCGCGGCTGCGTGCCTGCCTTCCACGGCGTGGTGGAGCGC
GACGGCGAAAGCTACCTGCAGCTGCAGGACCTGCTCGATGGCTTCGACGGACCTTGTGTG
CTCGACTGCAAAATGGGCGTCAGGACTTACCTAGAGGAGGAGCTGACCAAGGCCCGTGAG
CGGCCCAAGCTGCGGAAGGACATGTACAAGAAAATGCTGGCGGTGGATCCTGAAGCTCCC
ACGGAGGAGGAGCACGCGCAGCGCGCCGTCACCAAGCCGCGCTACATGCAGTGGCGGGAA
GGCATCAGCTCCAGCACCACCCTCGGCTTCCGCATCGAGGGCATCAAGAAAGCGGACGGC
TCCTGCAGCACCGACTTCAAGACTACGCGAAGCCGAGAGCAGGTGCTTCGCGTCTTTGAA
GAGTTTGTGCAAGGAGATGAGGAAGTGCTGAGGCGGTATCTGAACCGCCTGCAGCAGATC
CGGGACACCCTGGAGGTATCCGAGTTCTTCAGGAGGCACGAGGTGATCGGCAGCTCGCTC
CTCTTTGTGCACGATCACTGCCATCGCGCCGGCGTGTGGCTCATCGACTTCGGCAAGACC
ACGCCCCTCCCCGATGGCCAGATCCTGGACCACCGGCGGCCCTGGGAGGAGGGCAACCGC
GAGGACGGCTATTTGCTGGGGCTGGACAATCTCATTGGCATCCTGGCCAGCCTGGCTGAG
AGATGA
Protein Properties
Number of Residues 461
Molecular Weight 51008.32
Theoretical pI 7.657
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Inositol-trisphosphate 3-kinase A
MTLPGGPTGMARPGGARPCSPGLERAPRRSVGELRLLFEARCAAVAAAAAAGEPRARGAK
RRGGQVPNGLPRAPPAPVIPQLTVTAEEPDVPPTSPGPPERERDCLPAAGSSHLQQPRRL
STSSVSSTGSSSLLEDSEDDLLSDSESRSRGNVQLEAGEDVGQKNHWQKIRTMVNLPVIS
PFKKRYAWVQLAGHTGSFKAAGTSGLILKRCSEPERYCLARLMADALRGCVPAFHGVVER
DGESYLQLQDLLDGFDGPCVLDCKMGVRTYLEEELTKARERPKLRKDMYKKMLAVDPEAP
TEEEHAQRAVTKPRYMQWREGISSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVLRVFE
EFVQGDEEVLRRYLNRLQQIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKT
TPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASLAER
GenBank ID Protein 32105
UniProtKB/Swiss-Prot ID P23677
UniProtKB/Swiss-Prot Entry Name IP3KA_HUMAN
PDB IDs
GenBank Gene ID X54938
GeneCard ID ITPKA
GenAtlas ID ITPKA
HGNC ID HGNC:6178
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Takazawa K, Perret J, Dumont JE, Erneux C: Molecular cloning and expression of a human brain inositol 1,4,5-trisphosphate 3-kinase. Biochem Biophys Res Commun. 1991 Jan 31;174(2):529-35. [PubMed:1847047 ]
  3. Takazawa K, Perret J, Dumont JE, Erneux C: Human brain inositol 1,4,5-trisphosphate 3-kinase cDNA sequence. Nucleic Acids Res. 1990 Dec 11;18(23):7141. [PubMed:2175886 ]
  4. Gonzalez B, Schell MJ, Letcher AJ, Veprintsev DB, Irvine RF, Williams RL: Structure of a human inositol 1,4,5-trisphosphate 3-kinase: substrate binding reveals why it is not a phosphoinositide 3-kinase. Mol Cell. 2004 Sep 10;15(5):689-701. [PubMed:15350214 ]