You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00991
Secondary Accession Numbers
  • 6279
Name Cytochrome c1, heme protein, mitochondrial
Synonyms
  1. Complex III subunit 4
  2. Complex III subunit IV
  3. Cytochrome b-c1 complex subunit 4
  4. Cytochrome c-1
  5. Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit
Gene Name CYC1
Protein Type Unknown
Biological Properties
General Function Involved in iron ion binding
Specific Function This is the heme-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
electron carrier activity
iron ion binding
heme binding
Cellular Location
  1. Single-pass membrane protein
  2. Mitochondrion inner membrane
  3. Intermembrane side
Gene Properties
Chromosome Location Chromosome:8
Locus 8q24.3
SNPs CYC1
Gene Sequence
>978 bp
ATGGCGGCAGCTGCGGCTTCGCTTCGCGGGGTAGTGTTGGGCCCGCGGGGCGCGGGGCTC
CCGGGCGCGCGTGCCCGGGGTCTGCTGTGCAGCGCGCGGCCCGGGCAGCTCCCGCTACGG
ACACCTCAGGCAGTGGCCTTGTCGTCGAAGTCTGGCCTTTCCCGAGGCCGGAAAGTGATG
CTGTCAGCGCTGGGCATGCTGGCGGCAGGGGGTGCGGGGCTGGCCGTGGCTCTGCATTCG
GCTGTGAGTGCCAGTGACCTGGAGCTGCACCCCCCCAGCTATCCGTGGTCTCACCGTGGC
CTCCTCTCTTCCTTGGACCACACCAGCATCCGGAGGGGTTTCCAGGTATATAAGCAGGTG
TGCGCCTCCTGCCACAGCATGGACTTCGTGGCCTACCGCCACCTGGTGGGCGTGTGCTAC
ACGGAGGATGAAGCTAAGGAGCTGGCTGCGGAGGTGGAGGTTCAAGACGGCCCCAATGAA
GATGGGGAGATGTTCATGCGGCCAGGGAAGCTGTTCGACTATTTCCCAAAACCATACCCC
AACAGTGAGGCTGCTCGAGCTGCCAACAACGGAGCATTGCCCCCTGACCTCAGCTACATC
GTGCGAGCTAGGCATGGTGGTGAGGACTACGTCTTCTCCCTGCTCACGGGCTACTGCGAG
CCACCCACCGGGGTGTCACTGCGGGAAGGTCTCTACTTCAACCCCTACTTTCCTGGCCAG
GCCATTGCCATGGCCCCTCCCATCTACACAGATGTCTTAGAGTTTGACGATGGCACCCCA
GCTACCATGTCCCAGATAGCCAAGGATGTGTGCACCTTCCTGCGCTGGGCATCTGAGCCA
GAGCACGACCATCGAAAACGCATGGGGCTCAAGATGTTGATGATGATGGCTCTGCTGGTG
CCCCTGGTCTACACCATAAAGCGGCACAAGTGGTCAGTCCTGAAGAGTCGGAAGCTGGCA
TATCGGCCGCCCAAGTGA
Protein Properties
Number of Residues 325
Molecular Weight 35389.5
Theoretical pI 9.25
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 292-306
Protein Sequence
>Cytochrome c1, heme protein, mitochondrial
MAAAAASLRGVVLGPRGAGLPGARARGLLCSARPGQLPLRTPQAVALSSKSGLSRGRKVM
LSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQV
CASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYP
NSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQ
AIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLV
PLVYTIKRHKWSVLKSRKLAYRPPK
GenBank ID Protein 12654367
UniProtKB/Swiss-Prot ID P08574
UniProtKB/Swiss-Prot Entry Name CY1_HUMAN
PDB IDs
GenBank Gene ID BC001006
GeneCard ID CYC1
GenAtlas ID CYC1
HGNC ID HGNC:2579
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Valnot I, Kassis J, Chretien D, de Lonlay P, Parfait B, Munnich A, Kachaner J, Rustin P, Rotig A: A mitochondrial cytochrome b mutation but no mutations of nuclearly encoded subunits in ubiquinol cytochrome c reductase (complex III) deficiency. Hum Genet. 1999 Jun;104(6):460-6. [PubMed:10453733 ]
  3. Nishikimi M, Ohta S, Suzuki H, Tanaka T, Kikkawa F, Tanaka M, Kagawa Y, Ozawa T: Nucleotide sequence of a cDNA encoding the precursor to human cytochrome c1. Nucleic Acids Res. 1988 Apr 25;16(8):3577. [PubMed:2836796 ]
  4. Suzuki H, Hosokawa Y, Nishikimi M, Ozawa T: Structural organization of the human mitochondrial cytochrome c1 gene. J Biol Chem. 1989 Jan 25;264(3):1368-74. [PubMed:2536365 ]
  5. Nishikimi M, Suzuki H, Ohta S, Sakurai T, Shimomura Y, Tanaka M, Kagawa Y, Ozawa T: Isolation of a cDNA clone for human cytochrome c1 from a lambda gt11 expression library. Biochem Biophys Res Commun. 1987 May 29;145(1):34-9. [PubMed:3036122 ]