You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00993
Secondary Accession Numbers
  • 6281
Name Polypeptide N-acetylgalactosaminyltransferase 11
Synonyms
  1. GalNAc-T11
  2. Polypeptide GalNAc transferase 11
  3. Protein-UDP acetylgalactosaminyltransferase 11
  4. UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 11
  5. pp-GaNTase 11
Gene Name GALNT11
Protein Type Unknown
Biological Properties
General Function Involved in polypeptide N-acetylgalactosaminyltransfera
Specific Function Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Displays the same enzyme activity toward Muc1, Muc4.1, and EA2 than GALNT1. Does not appear to be involved in glycosylation of erythropoietin.
Pathways
  • Mucin type O-Glycan biosynthesis
  • protein glycosylation
Reactions
UDP-N-acetyl-alpha-D-galactosamine + polypeptide → Uridine 5'-diphosphate + N-acetyl-alpha-D-galactosaminyl-polypeptide details
UDP-N-acetyl-D-galactosamine + Protein serine → UDP + Tn antigen details
GO Classification
Biological Process
O-glycan processing
post-translational protein modification
Cellular Component
integral to membrane
Golgi membrane
Molecular Function
polypeptide N-acetylgalactosaminyltransferase activity
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 7
Locus 7q36.1
SNPs GALNT11
Gene Sequence
>1827 bp
ATGGGAAGTGTCACAGTTCGGTATTTCTGTTATGGGTGCCTTTTTACATCTGCGACCTGG
ACAGTTTTGCTTTTTGTTTATTTCAACTTCAGTGAAGTGACTCAGCCACTTAAGAATGTG
CCCGTCAAGGGGTCTGGGCCCCACGGACCATCTCCAAAAAAATTCTATCCCCGTTTCACT
CGAGGCCCAAGTCGAGTGCTCGAGCCACAGTTCAAAGCAAACAAAATTGACGATGTGATA
GACAGTCGTGTTGAAGATCCAGAAGAAGGCCACTTGAAATTCTCTTCTGAATTAGGTATG
ATTTTTAATGAACGCGATCAAGAGTTGAGAGACTTGGGCTATCAGAAACATGCTTTTAAT
ATGCTTATCAGTGACCGCTTGGGCTACCACAGAGATGTGCCAGACACAAGGAATGCAGCA
TGTAAAGAAAAGTTCTACCCACCTGACCTGCCAGCTGCTAGTGTTGTTATCTGTTTCTAT
AATGAAGCGTTTTCTGCCTTGCTTCGGACAGTGCACAGTGTCATAGACCGCACGCCAGCA
CACCTGCTTCATGAGATCATCCTTGTGGATGATGATAGTGACTTTGATGATTTGAAAGGA
GAACTAGATGAATATGTCCAAAAATACCTCCCTGGAAAAATTAAAGTCATAAGAAATACA
AAGCGTGAGGGGTTGATTCGAGGGAGAATGATTGGCGCGGCCCACGCGACAGGAGAAGTC
CTTGTGTTCCTGGACAGCCACTGTGAAGTGAATGTGATGTGGCTGCAGCCCTTGCTGGCC
GCCATCCGTGAGGACCGGCACACCGTGGTGTGCCCAGTGATTGACATCATCAGCGCCGAC
ACGCTGGCCTACAGCTCGTCCCCTGTCGTCCGCGGAGGGTTCAACTGGGGACTGCACTTC
AAATGGGATCTTGTCCCCCTTTCTGAGCTAGGACGAGCGGAGGGAGCCACTGCACCAATA
AAGTCACCAACAATGGCTGGAGGTTTGTTTGCCATGAACAGACAGTATTTCCATGAACTT
GGACAGTATGATAGTGGCATGGATATCTGGGGAGGAGAAAATTTGGAAATATCATTTCGG
ATCTGGATGTGTGGCGGTAAGCTCTTCATCATCCCTTGCTCTAGAGTAGGACACATTTTC
CGAAAAAGGCGACCATATGGATCTCCCGAAGGCCAGGACACCATGACACACAACTCTTTG
CGGCTGGCACATGTCTGGTTGGATGAATACAAGGAGCAGTATTTTTCCTTAAGACCTGAC
CTGAAGACGAAAAGCTATGGCAATATCAGTGAGCGTGTGGAACTGAGAAAGAAGTTGGGC
TGTAAATCATTTAAATGGTATTTGGATAATGTATACCCAGAGATGCAGATATCTGGGTCC
CACGCCAAACCCCAACAACCCATTTTTGTCAATAGAGGGCCAAAACGACCCAAAGTCCTT
CAACGTGGAAGGCTCTATCACCTCCAGACCAACAAATGCCTGGTGGCCCAGGGCCGCCCA
AGTCAGAAGGGAGGTCTCGTGGTGCTTAAGGCCTGTGACTACAGTGACCCAAATCAGATC
TGGATCTATAATGAAGAGCATGAATTGGTTTTAAATAGTCTCCTTTGTCTAGATATGTCA
GAGACTCGCTCATCAGACCCGCCACGGCTCATGAAATGCCACGGGTCAGGAGGATCCCAG
CAGTGGACCTTTGGGAAAAACAATCGGCTATACCAGGTGTCGGTTGGACAGTGCCTGAGA
GCAGTGGATCCCCTGGGTCAGAAGGGCTCTGTCGCCATGGCGATCTGCGATGGCTCCTCT
TCACAGCAGTGGCATTTGGAAGGTTAA
Protein Properties
Number of Residues 608
Molecular Weight 68918.365
Theoretical pI 8.188
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Polypeptide N-acetylgalactosaminyltransferase 11
MGSVTVRYFCYGCLFTSATWTVLLFVYFNFSEVTQPLKNVPVKGSGPHGPSPKKFYPRFT
RGPSRVLEPQFKANKIDDVIDSRVEDPEEGHLKFSSELGMIFNERDQELRDLGYQKHAFN
MLISDRLGYHRDVPDTRNAACKEKFYPPDLPAASVVICFYNEAFSALLRTVHSVIDRTPA
HLLHEIILVDDDSDFDDLKGELDEYVQKYLPGKIKVIRNTKREGLIRGRMIGAAHATGEV
LVFLDSHCEVNVMWLQPLLAAIREDRHTVVCPVIDIISADTLAYSSSPVVRGGFNWGLHF
KWDLVPLSELGRAEGATAPIKSPTMAGGLFAMNRQYFHELGQYDSGMDIWGGENLEISFR
IWMCGGKLFIIPCSRVGHIFRKRRPYGSPEGQDTMTHNSLRLAHVWLDEYKEQYFSLRPD
LKTKSYGNISERVELRKKLGCKSFKWYLDNVYPEMQISGSHAKPQQPIFVNRGPKRPKVL
QRGRLYHLQTNKCLVAQGRPSQKGGLVVLKACDYSDPNQIWIYNEEHELVLNSLLCLDMS
ETRSSDPPRLMKCHGSGGSQQWTFGKNNRLYQVSVGQCLRAVDPLGQKGSVAMAICDGSS
SQQWHLEG
GenBank ID Protein 5630076
UniProtKB/Swiss-Prot ID Q8NCW6
UniProtKB/Swiss-Prot Entry Name GLT11_HUMAN
PDB IDs Not Available
GenBank Gene ID AC006017
GeneCard ID GALNT11
GenAtlas ID GALNT11
HGNC ID HGNC:19875
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  4. Schwientek T, Bennett EP, Flores C, Thacker J, Hollmann M, Reis CA, Behrens J, Mandel U, Keck B, Schafer MA, Haselmann K, Zubarev R, Roepstorff P, Burchell JM, Taylor-Papadimitriou J, Hollingsworth MA, Clausen H: Functional conservation of subfamilies of putative UDP-N-acetylgalactosamine:polypeptide N-acetylgalactosaminyltransferases in Drosophila, Caenorhabditis elegans, and mammals. One subfamily composed of l(2)35Aa is essential in Drosophila. J Biol Chem. 2002 Jun 21;277(25):22623-38. Epub 2002 Mar 29. [PubMed:11925450 ]