You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00996
Secondary Accession Numbers
  • 6284
Name Probable polypeptide N-acetylgalactosaminyltransferase 8
Synonyms
  1. GalNAc-T8
  2. Polypeptide GalNAc transferase 8
  3. Protein-UDP acetylgalactosaminyltransferase 8
  4. UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 8
  5. pp-GaNTase 8
Gene Name GALNT8
Protein Type Unknown
Biological Properties
General Function Cell wall/membrane/envelope biogenesis
Specific Function Probably catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor (By similarity).
Pathways
  • Mucin type O-Glycan biosynthesis
  • protein glycosylation
Reactions
UDP-N-acetyl-alpha-D-galactosamine + polypeptide → Uridine 5'-diphosphate + N-acetyl-alpha-D-galactosaminyl-polypeptide details
UDP-N-acetyl-D-galactosamine + Protein serine → UDP + Tn antigen details
GO Classification
Biological Process
O-glycan processing
post-translational protein modification
Cellular Component
integral to membrane
Golgi membrane
Molecular Function
polypeptide N-acetylgalactosaminyltransferase activity
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 12
Locus 12p13.3
SNPs GALNT8
Gene Sequence
>1914 bp
ATGATGTTTTGGAGGAAACTCCCCAAAGCCCTCTTCATTGGGCTGACTCTGGCCATTGCT
GTCAATCTCCTTCTGGTATTTTCTAGCAAGGGGACTTTACAAAACCTGTTTACGGGTGGT
CTCCACAGGGAGCTTCCTTTACATCTGAATAAACGCTACGGGGCAGTGATAAAGAGACTC
TCCCACTTGGAGGTGGAATTGCAGGATCTGAAAGAAAGTATGAAATTAGCTCTGAGGCAA
CAAGAAAATGTGAACAGCACACTGAAGAGGGCGAAAGATGAAGTACGCCCTCTTCTAAAG
GCAATGGAAACCAAGGTGAATGAGACAAAGAAGCACAAAACCCAAATGAAACTCTTCCCA
CACTCACAGCTTTTCAGGCAATGGGGCGAGGATCTTTCTGAGGCCCAGCAGAAGGCGGCC
CAGGACCTCTTCCGGAAGTTTGGTTACAACGCGTACCTCAGCAACCAGCTGCCTCTCAAT
CGCACCATCCCCGACACGCGAGACTACAGATGTCTTCGGAAGACATATCCTTCCCAACTC
CCATCCCTCAGTGTCATTCTCATATTCGTGAATGAAGCTCTGTCCATTATACAACGGGCC
ATCACCAGTATCATCAACCGGACGCCCTCTCGATTGTTGAAGGAAATCATCTTGGTGGAT
GATTTCAGCTCAAATGGAGAACTAAAGGTACACTTGGATGAGAAGATTAAGCTTTACAAC
CAGAAGTATCCAGGACTACTGAAAATAATACGGCATCCTGAAAGGAAAGGTCTTGCTCAA
GCCCGCAACACTGGCTGGGAAGCTGCCACAGCAGACGTGGTCGCCATCTTGGATGCTCAC
ATTGAAGTCAATGTTGGGTGGGCAGAGCCAATCTTGGCTCGGATTCAGGAGGACCGCACT
GTGATTGTGTCTCCTGTGTTTGACAACATTCGTTTTGACACCTTCAAACTGGATAAGTAT
GAACTGGCAGTTGATGGGTTTAACTGGGAACTCTGGTGCCGCTACGATGCACTGCCACAA
GCCTGGATTGATCTGCATGATGTCACTGCCCCAGTGAAGAGTCCTTCAATCATGGGCATC
CTGGCTGCTAACAGGCACTTCCTGGGAGAGATCGGGTCTCTGGATGGTGGAATGCTCATC
TATGGAGGAGAGAACGTGGAGCTTAGCCTGAGGGTGTGGCAGTGTGGAGGGAAGGTCGAG
ATTTTGCCCTGTTCCCGGATTGCCCACCTAGAGAGACACCACAAGCCCTACGCCTTGGAT
CTCACCGCTGCCTTGAAGCGCAATGCTCTGCGAGTGGCCGAAATCTGGATGGATGAGCAC
AAACACATGGTCTACTTGGCCTGGAACATACCTCTCCAGAACTCTGGAATAGATTTTGGA
GACGTTTCTTCCAGAATGGCACTCCGGGAAAAACTGAAATGTAAAACTTTTGACTGGTAC
CTGAAAAATGTTTATCCACTCTTGAAGCCACTCCACACCATCGTGGGCTATGGAAGAATG
AAAAACCTATTGGATGAAAATGTCTGCTTGGATCAGGGACCCGTTCCAGGCAACACCCCC
ATCATGTATTACTGCCATGAATTCAGCTCACAGAATGTCTACTATCACCTAACTGGGGAG
CTCTATGTGGGACAACTGATTGCAGAGGCCAGTGCTAGTGATCGCTGCCTGACAGACCCT
GGCAAGGCGGAGAAGCCCACCTTAGAACCATGCTCCAAGGCAGCTAAGAATAGACTGCAT
ATATATTGGGATTTTAAACCGGGAGGAGCTGTCATAAACAGAGATACCAAGCGGTGTCTG
GAGATGAAGAAGGATCTTTTGGGTAGCCACGTGCTTGTGCTCCAGACCTGTAGCACGCAA
GTGTGGGAAATCCAGCACACTGTCAGAGACTGGGGTCAGACCAACAGCCAGTGA
Protein Properties
Number of Residues 637
Molecular Weight 72850.77
Theoretical pI 8.86
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Probable polypeptide N-acetylgalactosaminyltransferase 8
MMFWRKLPKALFIGLTLAIAVNLLLVFSSKGTLQNLFTGGLHRELPLHLNKRYGAVIKRL
SHLEVELQDLKESMKLALRQQENVNSTLKRAKDEVRPLLKAMETKVNETKKHKTQMKLFP
HSQLFRQWGEDLSEAQQKAAQDLFRKFGYNAYLSNQLPLNRTIPDTRDYRCLRKTYPSQL
PSLSVILIFVNEALSIIQRAITSIINRTPSRLLKEIILVDDFSSNGELKVHLDEKIKLYN
QKYPGLLKIIRHPERKGLAQARNTGWEAATADVVAILDAHIEVNVGWAEPILARIQEDRT
VIVSPVFDNIRFDTFKLDKYELAVDGFNWELWCRYDALPQAWIDLHDVTAPVKSPSIMGI
LAANRHFLGEIGSLDGGMLIYGGENVELSLRVWQCGGKVEILPCSRIAHLERHHKPYALD
LTAALKRNALRVAEIWMDEHKHMVYLAWNIPLQNSGIDFGDVSSRMALREKLKCKTFDWY
LKNVYPLLKPLHTIVGYGRMKNLLDENVCLDQGPVPGNTPIMYYCHEFSSQNVYYHLTGE
LYVGQLIAEASASDRCLTDPGKAEKPTLEPCSKAAKNRLHIYWDFKPGGAVINRDTKRCL
EMKKDLLGSHVLVLQTCSTQVWEIQHTVRDWGQTNSQ
GenBank ID Protein 7657926
UniProtKB/Swiss-Prot ID Q9NY28
UniProtKB/Swiss-Prot Entry Name GALT8_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ271385
GeneCard ID GALNT8
GenAtlas ID GALNT8
HGNC ID HGNC:4130
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. White KE, Lorenz B, Evans WE, Meitinger T, Strom TM, Econs MJ: Molecular cloning of a novel human UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase, GalNAc-T8, and analysis as a candidate autosomal dominant hypophosphatemic rickets (ADHR) gene. Gene. 2000 Apr 4;246(1-2):347-56. [PubMed:10767557 ]