You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00999
Secondary Accession Numbers
  • 6287
Name Polypeptide N-acetylgalactosaminyltransferase 10
Synonyms
  1. GalNAc-T10
  2. Polypeptide GalNAc transferase 10
  3. Protein-UDP acetylgalactosaminyltransferase 10
  4. UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 10
  5. pp-GaNTase 10
Gene Name GALNT10
Protein Type Unknown
Biological Properties
General Function Involved in metal ion binding
Specific Function Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has activity toward Muc5Ac and EA2 peptide substrates.
Pathways
  • Mucin type O-Glycan biosynthesis
  • protein glycosylation
Reactions
UDP-N-acetyl-alpha-D-galactosamine + polypeptide → Uridine 5'-diphosphate + N-acetyl-alpha-D-galactosaminyl-polypeptide details
UDP-N-acetyl-D-galactosamine + Protein serine → UDP + Tn antigen details
GO Classification
Biological Process
O-glycan processing
post-translational protein modification
Cellular Component
integral to membrane
Golgi membrane
Molecular Function
metal ion binding
polypeptide N-acetylgalactosaminyltransferase activity
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 5
Locus 5q33.2
SNPs GALNT10
Gene Sequence
>1812 bp
ATGAGGCGGAAGGAGAAGCGGCTCCTGCAGGCGGTGGCGCTGGTGCTGGCGGCCCTGGTC
CTCCTGCCCAACGTGGGGCTTTGGGCGCTGTACCGCGAGCGGCAGCCCGACGGCACCCCT
GGGGGATCGGGGGCGGCGGTGGCGCCGGCGGCGGGACAGGGCTCACACAGTCGACAAAAG
AAAACGTTTTTCTTGGGAGATGGGCAGAAGCTGAAGGACTGGCATGACAAGGAGGCCATC
CGGAGGGACGCTCAGCGCGTAGGAAATGGAGAACAAGGAAGACCTTACCCCATGACCGAT
GCTGAGAGAGTGGATCAGGCATACCGAGAAAATGGATTTAACATCTACGTCAGTGATAAA
ATCTCCTTGAATCGCTCTCTCCCAGATATCCGGCACCCAAACTGCAACAGCAAGCGCTAC
CTGGAGACACTTCCCAACACAAGCATCATCATCCCCTTCCACAACGAGGGCTGGTCCTCC
CTCCTCCGCACCGTCCACAGTGTGCTCAATCGCTCGCCTCCAGAGCTGGTCGCCGAGATT
GTACTGGTCGACGACTTCAGTGATCGAGAGCACCTGAAGAAGCCTCTTGAAGACTACATG
GCCCTTTTCCCCAGTGTGAGGATTCTTCGAACCAAGAAACGGGAAGGGCTGATAAGGACC
CGAATGCTGGGGGCCTCAGTGGCAACTGGGGATGTCATCACATTCTTGGATTCACACTGT
GAAGCCAATGTCAACTGGCTTCCCCCCTTGCTTGACCGCATTGCTCGGAACCGCAAGACC
ATTGTGTGCCCGATGATTGATGTAATTGACCATGACGACTTTCGGTACGAGACACAGGCA
GGGGATGCCATGCGGGGAGCCTTTGACTGGGAGATGTACTACAAGCGGATCCCGATCCCT
CCAGAACTGCAGAAAGCTGACCCCAGCGACCCATTTGAGTCTCCCGTGATGGCCGGTGGA
CTGTTCGCCGTGGATCGGAAGTGGTTCTGGGAACTCGGCGGGTATGACCCAGGCTTGGAG
ATCTGGGGAGGGGAGCAGTATGAAATCTCCTTCAAGGTGTGGATGTGTGGGGGCCGCATG
GAGGACATCCCCTGCTCCAGGGTGGGCCATATCTACAGGAAGTATGTGCCCTACAAGGTC
CCGGCCGGAGTCAGCCTGGCCCGGAACCTTAAGCGGGTGGCCGAAGTGTGGATGGATGAG
TACGCAGAGTACATTTACCAGCGCCGGCCTGAATACCGCCACCTCTCCGCTGGGGATGTC
GCAGTCCAGAAAAAGCTCCGCAGCTCCCTTAACTGCAAGAGTTTCAAGTGGTTTATGACG
AAGATAGCCTGGGACCTGCCCAAATTCTACCCACCCGTGGAGCCCCCGGCTGCAGCTTGG
GGGGAGATCCGAAATGTGGGCACAGGGCTGTGTGCAGACACAAAGCACGGGGCCTTGGGC
TCCCCACTAAGGCTAGAGGGCTGCGTCCGAGGCCGTGGGGAGGCTGCCTGGAACAACATG
CAGGTATTCACCTTCACCTGGAGAGAGGACATCCGGCCTGGAGACCCCCAGTACACCAAG
AAGTTCTGCTTTGATGCCATTTCCCACACCAGCCCTGTCACGCTGTACGACTGCCACAGC
ATGAAGGGCAACCAGCTGTGGAAATACCGCAAAGACAAGACCCTGTACCACCCTGTCAGT
GGCAGCTGCATGGACTGCAGTGAAAGTGACCATAGGATCTTCATGAACACCTGCAACCCA
TCCTCTCTCACCCAGCAATGGCTGTTTGAACACACCAACTCAACAGTCTTGGAAAAATTC
AATAGGAACTGA
Protein Properties
Number of Residues 603
Molecular Weight 68991.22
Theoretical pI 8.592
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Polypeptide N-acetylgalactosaminyltransferase 10
MRRKEKRLLQAVALVLAALVLLPNVGLWALYRERQPDGTPGGSGAAVAPAAGQGSHSRQK
KTFFLGDGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDK
ISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEI
VLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHC
EANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIP
PELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRM
EDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDV
AVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALG
SPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHS
MKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKF
NRN
GenBank ID Protein 28268676
UniProtKB/Swiss-Prot ID Q86SR1
UniProtKB/Swiss-Prot Entry Name GLT10_HUMAN
PDB IDs
GenBank Gene ID AB078145
GeneCard ID GALNT10
GenAtlas ID GALNT10
HGNC ID HGNC:19873
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Jikuya H, Takano J, Kikuno R, Hirosawa M, Nagase T, Nomura N, Ohara O: Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones. DNA Res. 2003 Feb 28;10(1):49-57. [PubMed:12693554 ]
  5. Cheng L, Tachibana K, Zhang Y, Guo Jm, Kahori Tachibana K, Kameyama A, Wang H, Hiruma T, Iwasaki H, Togayachi A, Kudo T, Narimatsu H: Characterization of a novel human UDP-GalNAc transferase, pp-GalNAc-T10. FEBS Lett. 2002 Nov 6;531(2):115-21. [PubMed:12417297 ]
  6. Kubota T, Shiba T, Sugioka S, Furukawa S, Sawaki H, Kato R, Wakatsuki S, Narimatsu H: Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10). J Mol Biol. 2006 Jun 9;359(3):708-27. Epub 2006 Apr 19. [PubMed:16650853 ]