Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01001
Secondary Accession Numbers
  • 6289
Name Putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
Synonyms
  1. GalNAc-T-like protein 3
  2. Polypeptide GalNAc transferase-like protein 3
  3. Protein-UDP acetylgalactosaminyltransferase-like protein 3
  4. UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 3
  5. Williams-Beuren syndrome chromosomal region 17 protein
  6. pp-GaNTase-like protein 3
Gene Name WBSCR17
Protein Type Unknown
Biological Properties
General Function Involved in polypeptide N-acetylgalactosaminyltransfera
Specific Function May catalyze the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor (By similarity).
Pathways
  • Mucin type O-glycan biosynthesis
  • protein glycosylation
Reactions
UDP-N-acetyl-alpha-D-galactosamine + polypeptide → Uridine 5'-diphosphate + N-acetyl-alpha-D-galactosaminyl-polypeptide details
UDP-N-acetyl-D-galactosamine + Protein serine → UDP + Tn antigen details
GO Classification
Biological Process
protein glycosylation
Cellular Component
integral to membrane
Golgi membrane
Molecular Function
polypeptide N-acetylgalactosaminyltransferase activity
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 7
Locus 7q11.23
SNPs WBSCR17
Gene Sequence
>1797 bp
ATGGCTTCACTGAGAAGAGTCAAAGTGCTGTTGGTGTTGAACTTGATCGCGGTAGCCGGC
TTCGTGCTCTTCCTGGCCAAGTGCCGGCCCATCGCGGTGCGCAGCGGAGACGCCTTCCAC
GAGATCCGGCCGCGCGCCGAGGTGGCCAACCTCAGCGCGCACAGCGCCAGCCCCATCCAG
GATGCGGTCCTGAAGCGCCTGTCGCTGCTGGAGGACATCGTGTACCGGCAGCTGAATGGC
TTATCCAAATCCCTTGGGCTCATTGAAGGTTATGGTGGGCGGGGTAAAGGGGGCCTTCCG
GCTACTCTTTCCCCGGCTGAAGAAGAAAAGGCTAAGGGACCCCATGAGAAGTATGGCTAC
AATTCATACCTCAGTGAAAAAATTTCACTGGACCGTTCCATTCCGGATTATCGTCCCACC
AAGTGTAAGGAGCTCAAGTACTCCAAGGACCTGCCCCAGATATCCATCATATTCATCTTC
GTGAACGAGGCCCTGTCGGTGATCCTGCGGTCCGTGCACAGTGCCGTCAATCACACGCCC
ACACACCTGCTGAAGGAAATCATTCTGGTGGATGACAACAGCGACGAAGAGGAGCTGAAG
GTCCCCCTAGAGGAGTATGTCCACAAACGCTACCCCGGGCTGGTGAAGGTGGTAAGAAAT
CAGAAGAGGGAAGGCCTGATCCGCGCTCGCATTGAGGGCTGGAAGGTGGCTACCGGGCAG
GTCACTGGCTTCTTTGATGCCCACGTGGAATTCACCGCTGGCTGGGCTGAGCCGGTTCTA
TCCCGCATCCAGGAAAACCGGAAGCGTGTGATCCTCCCCTCCATTGACAACATCAAACAG
GACAACTTTGAGGTGCAGCGGTACGAGAACTCGGCCCACGGGTACAGCTGGGAGCTGTGG
TGCATGTACATCAGCCCCCCAAAAGACTGGTGGGACGCCGGAGACCCTTCTCTCCCCATC
AGGACCCCAGCCATGATAGGCTGCTCGTTCGTGGTCAACAGGAAGTTCTTCGGTGAAATT
GGTCTTCTGGATCCTGGCATGGATGTATACGGAGGAGAAAATATTGAACTGGGAATCAAG
GTATGGCTCTGTGGGGGCAGCATGGAGGTCCTTCCTTGCTCACGGGTGGCCCACATTGAG
CGGAAGAAGAAGCCATATAATAGCAACATTGGCTTCTACACCAAGAGGAATGCTCTTCGC
GTTGCTGAGGTCTGGATGGACGATTACAAGTCTCATGTGTACATAGCGTGGAACCTGCCG
CTGGAGAATCCGGGAATTGACATCGGTGATGTCTCCGAAAGAAGAGCATTAAGGAAAAGT
TTAAAGTGTAAGAATTTCCAGTGGTACCTGGACCATGTTTACCCAGAAATGAGAAGATAC
AATAATACCGTTGCTTACGGGGAGCTTCGCAACAACAAGGCAAAAGACGTCTGCTTGGAC
CAGGGGCCGCTGGAGAACCACACAGCAATATTGTATCCGTGCCATGGCTGGGGACCACAG
CTTGCCCGCTACACCAAGGAAGGCTTCCTGCACTTGGGTGCCCTGGGGACCACCACACTC
CTCCCTGACACCCGCTGCCTGGTGGACAACTCCAAGAGTCGGCTGCCCCAGCTCCTGGAC
TGCGACAAGGTCAAGAGCAGCCTGTACAAGCGCTGGAACTTCATCCAGAATGGAGCCATC
ATGAACAAGGGCACGGGACGCTGCCTGGAGGTGGAGAACCGGGGCCTGGCTGGCATCGAC
CTCATCCTCCGCAGCTGCACAGGTCAGAGGTGGACCATTAAGAACTCCATCAAGTAG
Protein Properties
Number of Residues 598
Molecular Weight 67750.455
Theoretical pI 8.899
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKVPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
GenBank ID Protein 21552746
UniProtKB/Swiss-Prot ID Q6IS24
UniProtKB/Swiss-Prot Entry Name GLTL3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF410457
GeneCard ID WBSCR17
GenAtlas ID WBSCR17
HGNC ID HGNC:16347
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  3. Merla G, Ucla C, Guipponi M, Reymond A: Identification of additional transcripts in the Williams-Beuren syndrome critical region. Hum Genet. 2002 May;110(5):429-38. Epub 2002 Mar 28. [PubMed:12073013 ]