You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01003
Secondary Accession Numbers
  • 6291
Name N-acetylgalactosaminyltransferase 7
Synonyms
  1. GalNAc-T7
  2. Polypeptide GalNAc transferase 7
  3. Protein-UDP acetylgalactosaminyltransferase 7
  4. UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7
  5. pp-GaNTase 7
Gene Name GALNT7
Protein Type Unknown
Biological Properties
General Function Involved in polypeptide N-acetylgalactosaminyltransfera
Specific Function Glycopeptide transferase involved in O-linked oligosaccharide biosynthesis, which catalyzes the transfer of an N-acetyl-D-galactosamine residue to an already glycosylated peptide. In contrast to other proteins of the family, it does not act as a peptide transferase that transfers GalNAc onto serine or threonine residue on the protein receptor, but instead requires the prior addition of a GalNAc on a peptide before adding additional GalNAc moieties. Some peptide transferase activity is however not excluded, considering that its appropriate peptide substrate may remain unidentified
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location Chromosome:4
Locus 4q31.1
SNPs GALNT7
Gene Sequence
>1974 bp
ATGAGGCTGAAGATTGGGTTCATCTTACGCAGTTTGCTGGTGGTGGGAAGCTTCCTGGGG
CTAGTGGTCCTCTGGTCTTCCCTGACCCCGCGGCCGGACGACCCAAGCCCGCTGAGCAGG
ATGAGGGAAGACAGAGATGTCAATGACCCCATGCCCAACCGAGGCGGCAATGGACTAGCT
CCTGGGGAGGACAGATTCAAACCTGTGGTACCATGGCCTCATGTTGAAGGAGTAGAAGTG
GACTTAGAGTCTATTAGAAGAATAAACAAGGCCAAAAATGAACAAGAGCACCATGCTGGA
GGAGATTCCCAGAAAGATATCATGCAGAGGCAGTATCTCACATTTAAGCCTCAGACATTC
ACCTACCATGATCCTGTGCTTCGCCCAGGGATCCTCGGTAACTTTGAACCCAAAGAACCT
GAGCCTCCTGGAGTGGTTGGTGGCCCTGGAGAGAAAGCCAAGCCATTGGTTTTGGGACCA
GAATTCAAACAAGCAATTCAAGCCAGCATTAAAGAGTTTGGATTTAACATGGTGGCAAGT
GACATGATCTCACTGGACCGCAACGTCAATGACTTACGCCAAGAAGAATGCAAGTATTGG
CATTATGATGAAAACTTGCTCACTTCGAGCGTTGTCATTGTCTTCCATAATGAAGGATGG
TCAACCCTCATGAGAACAGTCCACAGTGTAATTAAAAGGACTCCAAGGAAATATTTAGCA
GAAATTGTGTTAATTGACGATTTCAGTAATAAAGAACACTTAAAAGAAAAACTGGATGAA
TATATTAAGCTGTGGAATGGCCTAGTGAAGGTATTTCGAAATGAAAGAAGGGAAGGTTTA
ATTCAAGCACGAAGTATTGGTGCTCAGAAGGCTAAACTTGGACAGGTTTTGATATACCTT
GATGCCCACTGTGAAGTGGCAGTTAACTGGTATGCACCACTTGTAGCTCCCATATCTAAG
GACAGAACCATTTGCACTGTGCCGCTTATAGATGTCATAAATGGCAACACATATGAAATT
ATACCCCAAGGGGGTGGTGATGAAGATGGGTATGCCCGAGGAGCATGGGATTGGAGTATG
CTCTGGAAACGGGTGCCTCTGACCCCTCAAGAGAAGAGACTGAGAAAAACAAAAACTGAA
CCGTATCGGTCCCCAGCCATGGCTGGGGGATTATGTGCCATTGAACGAGAGTTCTTCTTT
GAATTGGGTCTCTATGATCCAAGTCTCCAGATTTGGGGTGGTGAAAACTTTGAGATCTCA
TACAAGATATGGCAGTGTGGTGGCAAATTATTATTTGTTCCTTGTTCTCGTGTTGGACAT
ATCTACCGTCTTGAGGGCTGGCAAGGAAATCCTCCGCCCATTTATGTTGGGTCTTCTCCA
ACTCTGAAGAATTATGTTAGAGTTGTGGAGGTTTGGTGGGATGAATATAAAGACTACTTC
TATGCTAGTCGTCCTGAATCGCAGGCATTACCATATGGGGATATATCGGAGCTGAAAAAA
TTTCGAGAAGATCACAACTGCCAAAGTTTTAAGTGGTTCATGGAAGAAATAGCTTATGAT
ATCACCTCACACTACCCTTTGCCACCCAAAAATGTTGACTGGGGAGAAATCAGAGGCTTC
GAAACTGCTTACTGCATTGATAGCATGGGAAAAACAAATGGAGGCTTTGTTGAACTAGGA
CCCTGCCACAGGATGGGAGGGAATCAGCTTTTCAGAATCAATGAAGCAAATCAACTCATG
CAGTATGACCAGTGTTTGACAAAGGGAGCTGATGGATCAAAAGTTATGATTACACACTGT
AATCTAAATGAATTTAAGGAATGGCAGTACTTCAAGAACCTGCACAGATTTACTCATATT
CCTTCAGGAAAGTGTTTAGATCGCTCAGAGGTCCTGCATCAAGTATTCATCTCCAATTGT
GACTCCAGTAAAACGACTCAAAAATGGGAAATGAATAACATCCATAGTGTTTAG
Protein Properties
Number of Residues 657
Molecular Weight 75388.6
Theoretical pI 7.12
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 7-29
Protein Sequence
>N-acetylgalactosaminyltransferase 7
MRLKIGFILRSLLVVGSFLGLVVLWSSLTPRPDDPSPLSRMREDRDVNDPMPNRGGNGLA
PGEDRFKPVVPWPHVEGVEVDLESIRRINKAKNEQEHHAGGDSQKDIMQRQYLTFKPQTF
TYHDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEFKQAIQASIKEFGFNMVAS
DMISLDRSVNDLRQEECKYWHYDENLLTSSVVIVFHNEGWSTLMRTVHSVIKRTPRKYLA
EIVLIDDFSNKEHLKEKLDEYIKLWNGLVKVFRNERREGLIQARSIGAQKAKLGQVLIYL
DAHCEVAVNWYAPLVAPISKDRTICTVPLIDVINGNTYEIIPQGGGDEDGYARGAWDWSM
LWKRVPLTPQEKRLRKTKTEPYRSPAMAGGLFAIEREFFFELGLYDPGLQIWGGENFEIS
YKIWQCGGKLLFVPCSRVGHIYRLEGWQGNPPPIYVGSSPTLKNYVRVVEVWWDEYKDYF
YASRPESQALPYGDISELKKFREDHNCKSFKWFMEEIAYDITSHYPLPPKNVDWGEIRGF
ETAYCIDSMGKTNGGFVELGPCHRMGGNQLFRINEANQLMQYDQCLTKGADGSKVMITHC
NLNEFKEWQYFKNLHRFTHIPSGKCLDRSEVLHQVFISNCDSSKTTQKWEMNNIHSV
GenBank ID Protein 6318186
UniProtKB/Swiss-Prot ID Q86SF2
UniProtKB/Swiss-Prot Entry Name GALT7_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ002744
GeneCard ID GALNT7
GenAtlas ID GALNT7
HGNC ID HGNC:4129
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T: Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. DNA Res. 2005;12(2):117-26. [PubMed:16303743 ]
  3. Bennett EP, Hassan H, Hollingsworth MA, Clausen H: A novel human UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase, GalNAc-T7, with specificity for partial GalNAc-glycosylated acceptor substrates. FEBS Lett. 1999 Oct 29;460(2):226-30. [PubMed:10544240 ]