Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01004
Secondary Accession Numbers
  • 6292
Name Polypeptide N-acetylgalactosaminyltransferase 6
Synonyms
  1. GalNAc-T6
  2. Polypeptide GalNAc transferase 6
  3. Protein-UDP acetylgalactosaminyltransferase 6
  4. UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 6
  5. pp-GaNTase 6
Gene Name GALNT6
Protein Type Unknown
Biological Properties
General Function Cell wall/membrane/envelope biogenesis
Specific Function Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. May participate in synthesis of oncofetal fibronectin. Has activity toward Muc1a, Muc2, EA2 and fibronectin peptides.
Pathways
  • Mucin type O-glycan biosynthesis
  • protein glycosylation
Reactions
UDP-N-acetyl-alpha-D-galactosamine + polypeptide → Uridine 5'-diphosphate + N-acetyl-alpha-D-galactosaminyl-polypeptide details
UDP-N-acetyl-D-galactosamine + Protein serine → UDP + Tn antigen details
GO Classification
Biological Process
O-glycan processing
post-translational protein modification
Cellular Component
perinuclear region of cytoplasm
integral to membrane
Golgi membrane
Molecular Function
polypeptide N-acetylgalactosaminyltransferase activity
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 12
Locus 12q13
SNPs GALNT6
Gene Sequence
>1869 bp
ATGAGGCTCCTCCGCAGACGCCACATGCCCCTGCGCCTGGCCATGGTGGGCTGCGCCTTT
GTGCTCTTCCTCTTCCTCCTGCATAGGGATGTGAGCAGCAGAGAGGAGGCCACAGAGAAG
CCGTGGCTGAAGTCCCTGGTGAGCCGGAAGGATCACGTCCTGGACCTCATGCTGGAGGCC
ATGAACAACCTTAGAGATTCAATGCCCAAGCTCCAAATCAGGGCTCCAGAAGCCCAGCAG
ACTCTGTTCTCCATAAACCAGTCCTGCCTCCCTGGGTTCTATACCCCAGCTGAACTGAAG
CCCTTCTGGGAACGGCCACCACAGGACCCCAATGCCCCTGGGGCAGATGGAAAAGCATTT
CAGAAGAGCAAGTGGACCCCCCTGGAGACCCAGGAAAAGGAAGAAGGCTATAAGAAGCAC
TGTTTCAATGCCTTTGCCAGCGACCGGATCTCCCTGCAGAGGTCCCTGGGGCCAGACACC
CGACCACCTGAGTGTGTGGACCAGAAGTTCCGGCGCTGCCCCCCACTGGCCACCACCAGC
GTGATCATTGTGTTCCACAACGAAGCCTGGTCCACACTGCTGCGAACAGTGTACAGCGTC
CTACACACCACCCCTGCCATCTTGCTCAAGGAGATCATACTGGTGGATGATGCCAGCACA
GAGGAGCACCTAAAGGAGAAGCTGGAGCAGTACGTGAAGCAGCTGCAGGTGGTGAGGGTG
GTGCGGCAGGAGGAGCGGAAGGGGCTGATCACCGCCCGGCTGCTGGGGGCCAGCGTGGCA
CAGGCGGAGGTGCTCACGTTCCTGGATGCCCACTGTGAGTGCTTCCACGGCTGGCTGGAG
CCCCTCCTGGCTCGAATCGCTGAGGACAAGACAGTGGTGGTGAGCCCAGACATCGTCACC
ATCGACCTTAATACTTTTGAGTTCGCCAAGCCCGTCCAGAGGGGCAGAGTCCATAGCCGA
GGCAACTTTGACTGGAGCCTGACCTTCGGCTGGGAAACACTTCCTCCACATGAGAAGCAG
AGGCGCAAGGATGAAACCTACCCCATCAAATCCCCGACGTTTGCTGGTGGCCTCTTCTCC
ATCTCCAAGTCCTACTTTGAGCACATCGGTACCTATGATAATCAGATGGAGATCTGGGGA
GGGGAGAACGTGGAAATGTCCTTCCGGGTGTGGCAGTGTGGGGGCCAGCTGGAGATCATC
CCCTGCTCTGTCGTAGGCCATGTGTTCCGGACCAAGAGCCCCCACACCTTCCCCAAGGGC
ACTAGTGTCATTGCTCGCAATCAAGTGCGCCTGGCAGAGGTCTGGATGGACAGCTACAAG
AAGATTTTCTATAGGAGAAATCTGCAGGCAGCAAAGATGGCCCAAGAGAAATCCTTCGGT
GACATTTCGGAACGACTGCAGCTGAGGGAACAACTGCACTGTCACAACTTTTCCTGGTAC
CTGCACAATGTCTACCCAGAGATGTTTGTTCCTGACCTGACGCCCACCTTCTATGGTGCC
ATCAAGAACCTCGGCACCAACCAATGCCTGGATGTGGGTGAGAACAACCGCGGGGGGAAG
CCCCTCATCATGTACTCCTGCCACGGCCTTGGCGGCAACCAGTACTTTGAGTACACAACT
CAGAGGGACCTTCGCCACAACATCGCAAAGCAGCTGTGTCTACATGTCAGCAAGGGTGCT
CTGGGCCTTGGGAGCTGTCACTTCACTGGCAAGAATAGCCAGGTCCCCAAGGACGAGGAA
TGGGAATTGGCCCAGGATCAGCTCATCAGGAACTCAGGATCTGGTACCTGCCTGACATCC
CAGGACAAAAAGCCAGCCATGGCCCCCTGCAATCCCAGTGACCCCCATCAGTTGTGGCTC
TTTGTCTAG
Protein Properties
Number of Residues 622
Molecular Weight 71158.055
Theoretical pI 8.171
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Polypeptide N-acetylgalactosaminyltransferase 6
MRLLRRRHMPLRLAMVGCAFVLFLFLLHRDVSSREEATEKPWLKSLVSRKDHVLDLMLEA
MNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDPNAPGADGKAF
QKSKWTPLETQEKEEGYKKHCFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPLATTS
VIIVFHNEAWSTLLRTVYSVLHTTPAILLKEIILVDDASTEEHLKEKLEQYVKQLQVVRV
VRQEERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTVVVSPDIVT
IDLNTFEFAKPVQRGRVHSRGNFDWSLTFGWETLPPHEKQRRKDETYPIKSPTFAGGLFS
ISKSYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKG
TSVIARNQVRLAEVWMDSYKKIFYRRNLQAAKMAQEKSFGDISERLQLREQLHCHNFSWY
LHNVYPEMFVPDLTPTFYGAIKNLGTNQCLDVGENNRGGKPLIMYSCHGLGGNQYFEYTT
QRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTS
QDKKPAMAPCNPSDPHQLWLFV
GenBank ID Protein 115298684
UniProtKB/Swiss-Prot ID Q8NCL4
UniProtKB/Swiss-Prot Entry Name GALT6_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_007210.3
GeneCard ID GALNT6
GenAtlas ID GALNT6
HGNC ID HGNC:4128
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bennett EP, Hassan H, Mandel U, Hollingsworth MA, Akisawa N, Ikematsu Y, Merkx G, van Kessel AG, Olofsson S, Clausen H: Cloning and characterization of a close homologue of human UDP-N-acetyl-alpha-D-galactosamine:Polypeptide N-acetylgalactosaminyltransferase-T3, designated GalNAc-T6. Evidence for genetic but not functional redundancy. J Biol Chem. 1999 Sep 3;274(36):25362-70. [PubMed:10464263 ]