Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01009
Secondary Accession Numbers
  • 6297
  • HMDBP09391
Name Polypeptide N-acetylgalactosaminyltransferase 5
Synonyms
  1. GalNAc-T5
  2. Polypeptide GalNAc transferase 5
  3. Protein-UDP acetylgalactosaminyltransferase 5
  4. UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 5
  5. pp-GaNTase 5
  6. SubName: cDNA FLJ75131, highly similar to Homo sapiens UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 5 (GalNAc-T5) (GALNT5), mRNA
Gene Name GALNT5
Protein Type Unknown
Biological Properties
General Function Involved in polypeptide N-acetylgalactosaminyltransfera
Specific Function Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has activity toward EA2 peptide substrate, but has a weak activity toward Muc2 or Muc1b substrates (By similarity).
Pathways
  • Mucin type O-glycan biosynthesis
  • protein glycosylation
Reactions
UDP-N-acetyl-alpha-D-galactosamine + polypeptide → Uridine 5'-diphosphate + N-acetyl-alpha-D-galactosaminyl-polypeptide details
UDP-N-acetyl-D-galactosamine + Protein serine → UDP + Tn antigen details
GO Classification
Biological Process
O-glycan processing
glycosaminoglycan biosynthetic process
post-translational protein modification
Cellular Component
integral to membrane
Golgi membrane
Molecular Function
polypeptide N-acetylgalactosaminyltransferase activity
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 2
Locus 2q24.1
SNPs GALNT5
Gene Sequence
>2823 bp
ATGAACAGGATCCGAAAGTTTTTCCGAGGAAGTGGGCGAGTCTTGGCATTTATCTTTGTA
GCTTCTGTCATCTGGCTCCTCTTTGACATGGCAGCTCTCCGCCTCTCATTCAGTGAGATC
AACACTCGGGTCATCAAGGAAGACATTGTGAGGAGGGAGCGGATAGGATTCAGAGTTCAG
CCAGACCAAGGAAAAATTTTTTACAGCAGCATAAAAGAGATGAAACCTCCCCTAAGGGGA
CATGGGAAAGGGGCATGGGGCAAAGAGAATGTTAGAAAAACTGAGGAGAGTGTGCTCAAG
GTTGAGGTGGACTTGGACCAAACCCAGAGGGAAAGAAAAATGCAGAATGCCCTGGGAAGG
GGCAAGGTTGTGCCGTTGTGGCATCCTGCACATCTGCAGACCCTCCCTGTGACTCCTAAC
AAGCAGAAGACAGACGGGAGAGGCACCAAACCTGAAGCCTCCTCTCACCAGGGGACACCA
AAGCAAACGACAGCTCAGGGGGCTCCAAAGACCTCATTCATAGCAGCAAAAGGAACTCAG
GTAGTCAAAATATCAGTACACATGGGACGTGTCAGTTTAAAACAGGAGCCCCGGAAGAGT
CATAGTCCCAGCAGTGACACATCAAAACTAGCAGCTGAAAGGGACTTGAATGTGACCATC
AGTCTTAGTACTGATAGACCAAAGCAGCGATCACAGGCAGTAGCAAACGAGAGGGCACAC
CCTGCCAGCACAGCAGTGCCGAAGTCTGGGGAAGCCATGGCCTTAAACAAAACTAAGACT
CAGAGCAAAGAAGTCAATGCAAATAAACACAAAGCCAATACGAGTCTTCCTTTTCCTAAG
TTCACTGTCAATTCAAATCGCTTAAGGAAGCAATCTATTAATGAGACACCTTTGGGAAGT
TTGTCAAAGGATGATGGAGCTAGAGGGGCTCATGGGAAGAAACTCAATTTCTCTGAAAGC
CATCTTGTGATTATAACCAAAGAGGAAGAGCAAAAGGCAGACCCCAAAGAGGTCTCTAAT
TCTAAAACCAAAACAATATTTCCTAAAGTATTGGGTAAAAGCCAAAGTAAACACATTTCC
AGGAATAGAAGTGAGATGTCTTCCTCTTCACTTGCTCCACATAGAGTGCCACTGTCCCAA
ACTAACCATGCTTTAACTGGAGGGCTAGAGCCAGCAAAAATCAACATAACTGCCAAAGCC
CCCTCTACAGAATACAACCAGAGTCATATAAAAGCCCTTTTACCTGAAGACAGTGGAACG
CACCAGGTGTTAAGAATTGATGTGACACTTTCTCCAAGGGACCCCAAAGCTCCAGGGCAG
TTTGGGCGTCCTGTAGTTGTCCCCCATGGAAAGGAGAAGGAGGCAGAAAGAAGATGGAAA
GAAGGAAACTTCAATGTCTACCTTAGCGATTTGATCCCAGTGGATAGAGCCATTGAAGAC
ACCAGACCTGCTGGATGTGCAGAGCAGCTAGTTCACAATAACCTCCCAACCACCAGTGTC
ATCATGTGCTTTGTGGATGAAGTGTGGTCCACTCTCCTGAGATCTGTTCACAGTGTCATC
AATCGCTCTCCTCCACACCTCATCAAGGAGATTCTGCTGGTAGATGACTTCAGCACCAAA
GACTATCTAAAAGATAATTTGGATAAATACATGTCCCAGTTTCCAAAAGTTCGGATTCTT
CGCCTCAAAGAGAGACATGGCTTAATAAGGGCCAGGCTGGCAGGAGCACAGAATGCAACA
GGTGATGTGTTGACATTTTTAGATTCTCATGTGGAATGTAACGTTGGTTGGTTGGAACCT
CTTCTGGAAAGAGTTTATTTAAGTAGAAAGAAAGTGGCCTGTCCAGTAATCGAAGTCATC
AATGATAAGGATATGAGTTACATGACAGTGGATAACTTTCAAAGAGGCATCTTTGTGTGG
CCCATGAACTTTGGTTGGAGAACAATTCCTCCAGATGTCATTGCAAAAAACAGAATTAAA
GAAACTGATACAATAAGGTGCCCTGTCATGGCTGGTGGATTGTTTTCTATTGACAAAAGT
TACTTTTTTGAACTTGGAACATACGACCCTGGCCTTGATGTTTGGGGTGGGGAAAATATG
GAGCTCTCATTCAAGGTGTGGATGTGTGGTGGTGAAATTGAGATCATTCCCTGCTCCCGA
GTGGGCCATATATTCAGAAATGACAATCCATATTCCTTCCCCAAAGACCGGATGAAGACA
GTGGAGCGGAACTTGGTGCGGGTTGCCGAGGTCTGGCTGGATGAGTATAAGGAGCTGTTC
TATGGCCACGGAGACCACCTCATCGACCAAGGGCTAGATGTTGGCAACCTCACCCAGCAA
AGGGAGCTGCGAAAGAAACTGAAGTGCAAAAGTTTCAAATGGTACTTGGAGAATGTCTTT
CCTGACTTAAGGGCTCCCATTGTGAGAGCTAGTGGTGTGCTTATTAATGTGGCTTTGGGT
AAATGCATTTCCATTGAAAACACTACAGTCATTCTGGAAGACTGCGATGGGAGCAAAGAG
CTTCAACAATTTAATTACACCTGGTTAAGACTTATTAAATGTGGAGAATGGTGTATAGCC
CCCATCCCTGATAAAGGAGCCGTAAGGCTGCACCCTTGTGATAACAGAAACAAAGGGCTA
AAATGGCTGCATAAATCAACATCAGTCTTTCATCCAGAACTGGTGAATCACATTGTTTTT
GAAAACAATCAGCAATTATTATGCTTGGAAGGAAATTTTTCTCAAAAGATCCTGAAAGTA
GCTGCCTGTGACCCAGTGAAGCCATATCAAAAGTGGAAATTTGAAAAATATTATGAAGCC
TGA
Protein Properties
Number of Residues 940
Molecular Weight 106265.345
Theoretical pI 9.465
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Polypeptide N-acetylgalactosaminyltransferase 5
MNRIRKFFRGSGRVLAFIFVASVIWLLFDMAALRLSFSEINTRVIKEDIVRRERIGFRVQ
PDQGKIFYSSIKEMKPPLRGHGKGAWGKENVRKTEESVLKVEVDLDQTQRERKMQNALGR
GKVVPLWHPAHLQTLPVTPNKQKTDGRGTKPEASSHQGTPKQTTAQGAPKTSFIAAKGTQ
VVKISVHMGRVSLKQEPRKSHSPSSDTSKLAAERDLNVTISLSTDRPKQRSQAVANERAH
PASTAVPKSGEAMALNKTKTQSKEVNANKHKANTSLPFPKFTVNSNRLRKQSINETPLGS
LSKDDGARGAHGKKLNFSESHLVIITKEEEQKADPKEVSNSKTKTIFPKVLGKSQSKHIS
RNRSEMSSSSLAPHRVPLSQTNHALTGGLEPAKINITAKAPSTEYNQSHIKALLPEDSGT
HQVLRIDVTLSPRDPKAPGQFGRPVVVPHGKEKEAERRWKEGNFNVYLSDLIPVDRAIED
TRPAGCAEQLVHNNLPTTSVIMCFVDEVWSTLLRSVHSVINRSPPHLIKEILLVDDFSTK
DYLKDNLDKYMSQFPKVRILRLKERHGLIRARLAGAQNATGDVLTFLDSHVECNVGWLEP
LLERVYLSRKKVACPVIEVINDKDMSYMTVDNFQRGIFVWPMNFGWRTIPPDVIAKNRIK
ETDTIRCPVMAGGLFSIDKSYFFELGTYDPGLDVWGGENMELSFKVWMCGGEIEIIPCSR
VGHIFRNDNPYSFPKDRMKTVERNLVRVAEVWLDEYKELFYGHGDHLIDQGLDVGNLTQQ
RELRKKLKCKSFKWYLENVFPDLRAPIVRASGVLINVALGKCISIENTTVILEDCDGSKE
LQQFNYTWLRLIKCGEWCIAPIPDKGAVRLHPCDNRNKGLKWLHKSTSVFHPELVNHIVF
ENNQQLLCLEGNFSQKILKVAACDPVKPYQKWKFEKYYEA
GenBank ID Protein 32698686
UniProtKB/Swiss-Prot ID Q7Z7M9
UniProtKB/Swiss-Prot Entry Name GALT5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014568.1
GeneCard ID GALNT5
GenAtlas ID GALNT5
HGNC ID HGNC:4127
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Simmons AD, Musy MM, Lopes CS, Hwang LY, Yang YP, Lovett M: A direct interaction between EXT proteins and glycosyltransferases is defective in hereditary multiple exostoses. Hum Mol Genet. 1999 Nov;8(12):2155-64. [PubMed:10545594 ]
  4. Venter JC, Adams MD, Myers EW, Li PW, Mural RJ, Sutton GG, Smith HO, Yandell M, Evans CA, Holt RA, Gocayne JD, Amanatides P, Ballew RM, Huson DH, Wortman JR, Zhang Q, Kodira CD, Zheng XH, Chen L, Skupski M, Subramanian G, Thomas PD, Zhang J, Gabor Miklos GL, Nelson C, Broder S, Clark AG, Nadeau J, McKusick VA, Zinder N, Levine AJ, Roberts RJ, Simon M, Slayman C, Hunkapiller M, Bolanos R, Delcher A, Dew I, Fasulo D, Flanigan M, Florea L, Halpern A, Hannenhalli S, Kravitz S, Levy S, Mobarry C, Reinert K, Remington K, Abu-Threideh J, Beasley E, Biddick K, Bonazzi V, Brandon R, Cargill M, Chandramouliswaran I, Charlab R, Chaturvedi K, Deng Z, Di Francesco V, Dunn P, Eilbeck K, Evangelista C, Gabrielian AE, Gan W, Ge W, Gong F, Gu Z, Guan P, Heiman TJ, Higgins ME, Ji RR, Ke Z, Ketchum KA, Lai Z, Lei Y, Li Z, Li J, Liang Y, Lin X, Lu F, Merkulov GV, Milshina N, Moore HM, Naik AK, Narayan VA, Neelam B, Nusskern D, Rusch DB, Salzberg S, Shao W, Shue B, Sun J, Wang Z, Wang A, Wang X, Wang J, Wei M, Wides R, Xiao C, Yan C, Yao A, Ye J, Zhan M, Zhang W, Zhang H, Zhao Q, Zheng L, Zhong F, Zhong W, Zhu S, Zhao S, Gilbert D, Baumhueter S, Spier G, Carter C, Cravchik A, Woodage T, Ali F, An H, Awe A, Baldwin D, Baden H, Barnstead M, Barrow I, Beeson K, Busam D, Carver A, Center A, Cheng ML, Curry L, Danaher S, Davenport L, Desilets R, Dietz S, Dodson K, Doup L, Ferriera S, Garg N, Gluecksmann A, Hart B, Haynes J, Haynes C, Heiner C, Hladun S, Hostin D, Houck J, Howland T, Ibegwam C, Johnson J, Kalush F, Kline L, Koduru S, Love A, Mann F, May D, McCawley S, McIntosh T, McMullen I, Moy M, Moy L, Murphy B, Nelson K, Pfannkoch C, Pratts E, Puri V, Qureshi H, Reardon M, Rodriguez R, Rogers YH, Romblad D, Ruhfel B, Scott R, Sitter C, Smallwood M, Stewart E, Strong R, Suh E, Thomas R, Tint NN, Tse S, Vech C, Wang G, Wetter J, Williams S, Williams M, Windsor S, Winn-Deen E, Wolfe K, Zaveri J, Zaveri K, Abril JF, Guigo R, Campbell MJ, Sjolander KV, Karlak B, Kejariwal A, Mi H, Lazareva B, Hatton T, Narechania A, Diemer K, Muruganujan A, Guo N, Sato S, Bafna V, Istrail S, Lippert R, Schwartz R, Walenz B, Yooseph S, Allen D, Basu A, Baxendale J, Blick L, Caminha M, Carnes-Stine J, Caulk P, Chiang YH, Coyne M, Dahlke C, Mays A, Dombroski M, Donnelly M, Ely D, Esparham S, Fosler C, Gire H, Glanowski S, Glasser K, Glodek A, Gorokhov M, Graham K, Gropman B, Harris M, Heil J, Henderson S, Hoover J, Jennings D, Jordan C, Jordan J, Kasha J, Kagan L, Kraft C, Levitsky A, Lewis M, Liu X, Lopez J, Ma D, Majoros W, McDaniel J, Murphy S, Newman M, Nguyen T, Nguyen N, Nodell M, Pan S, Peck J, Peterson M, Rowe W, Sanders R, Scott J, Simpson M, Smith T, Sprague A, Stockwell T, Turner R, Venter E, Wang M, Wen M, Wu D, Wu M, Xia A, Zandieh A, Zhu X: The sequence of the human genome. Science. 2001 Feb 16;291(5507):1304-51. [PubMed:11181995 ]