You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01052
Secondary Accession Numbers
  • 6341
Name Sphingosine-1-phosphate lyase 1
Synonyms
  1. SP-lyase 1
  2. SPL 1
  3. Sphingosine-1-phosphate aldolase
  4. hSPL
  5. S1PL
Gene Name SGPL1
Protein Type Enzyme
Biological Properties
General Function Involved in carboxy-lyase activity
Specific Function Cleaves phosphorylated sphingoid bases (PSBs), such as sphingosine-1-phosphate, into fatty aldehydes and phosphoethanolamine. Elevates stress-induced ceramide production and apoptosis.
Pathways
  • Fabry disease
  • Gaucher Disease
  • Globoid Cell Leukodystrophy
  • Krabbe disease
  • Metachromatic Leukodystrophy (MLD)
  • Sphingolipid Metabolism
  • sphingolipid metabolism
Reactions
Sphinganine 1-phosphate → O-Phosphoethanolamine + Palmitaldehyde details
Sphingosine 1-phosphate → O-Phosphoethanolamine + Hexadecenal details
GO Classification
Biological Process
small molecule metabolic process
estrogen metabolic process
spermatogenesis
sphingolipid catabolic process
phospholipid metabolic process
ceramide metabolic process
apoptotic process
Leydig cell differentiation
face morphogenesis
palate development
sphingolipid biosynthetic process
hemopoiesis
skeletal system morphogenesis
regulation of multicellular organism growth
platelet-derived growth factor receptor signaling pathway
vasculogenesis
androgen metabolic process
carboxylic acid metabolic process
fibroblast migration
luteinization
kidney development
post-embryonic development
Cellular Component
integral to endoplasmic reticulum membrane
Function
binding
catalytic activity
lyase activity
carbon-carbon lyase activity
carboxy-lyase activity
cofactor binding
pyridoxal phosphate binding
Molecular Function
pyridoxal phosphate binding
sphinganine-1-phosphate aldolase activity
carboxy-lyase activity
Process
metabolic process
cellular metabolic process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Single-pass type III membrane protein
Gene Properties
Chromosome Location 10
Locus 10q21
SNPs SGPL1
Gene Sequence
>1707 bp
ATGCCTAGCACAGACCTTCTGATGTTGAAGGCCTTTGAGCCCTACTTAGAGATTTTGGAA
GTATACTCCACAAAAGCCAAGAATTATGTAAATGGACATTGCACCAAGTATGAGCCCTGG
CAGCTAATTGCATGGAGTGTCGTGTGGACCCTGCTGATAGTCTGGGGATATGAGTTTGTC
TTCCAGCCAGAGAGTTTATGGTCAAGGTTTAAAAAGAAATGTTTTAAGCTCACCAGGAAG
ATGCCCATTATTGGTCGTAAGATTCAAGACAAGTTGAACAAGACCAAGGATGATATTAGC
AAGAACATGTCATTCCTGAAAGTGGACAAAGAGTATGTGAAAGCTTTACCCTCCCAGGGT
CTGAGCTCATCTGCTGTTTTGGAGAAACTTAAGGAGTACAGCTCTATGGACGCCTTCTGG
CAAGAGGGGAGAGCCTCTGGAACAGTGTACAGTGGGGAGGAGAAGCTCACTGAGCTCCTT
GTGAAGGCTTATGGAGATTTTGCATGGAGTAACCCCCTGCATCCAGATATCTTCCCAGGA
CTACGCAAGATAGAGGCAGAAATTGTGAGGATAGCTTGTTCCCTGTTCAATGGGGGACCA
GATTCGTGTGGATGTGTGACTTCTGGGGGAACAGAAAGCATACTGATGGCCTGCAAAGCA
TATCGGGATCTGGCCTTTGAGAAGGGGATCAAAACTCCAGAAATTGTGGCTCCCCAAAGT
GCCCATGCTGCATTTAACAAAGCAGCCAGTTACTTTGGGATGAAGATTGTGCGGGTCCCA
TTGACGAAGATGATGGAGGTGGATGTGCGGGCAATGAGAAGAGCTATCTCCAGGAACACT
GCCATGCTCGTCTGTTCTACCCCACAGTTTCCTCATGGTGTAATAGATCCTGTCCCTGAA
GTGGCCAAGCTGGCTGTCAAATACAAAATACCCCTTCATGTCGACGCTTGTCTGGGAGGC
TTCCTCATCGTCTTTATGGAGAAAGCAGGATACCCACTGGAGCACCCATTTGATTTCCGG
GTGAAAGGTGTAACCAGCATTTCAGCTGACACCCATAAGTATGGCTATGCCCCAAAAGGC
TCATCATTGGTGTTGTATAGTGACAAGAAGTACAGGAACTATCAGTTCTTCGTCGATACA
GATTGGCAGGGTGGCATCTATGCTTCCCCAACCATCGCAGGCTCACGGCCTGGTGGCATT
AGCGCAGCTGCTTGGGCTGCCTTGATGCACTTCGGTGAGAACGGCTATGTTGAAGCTACC
AAACAGATCATCAAAACTGCTCGCTTCCTCAAGTCAGAACTGGAAAATATCAAAGGCATC
TTTGTTTTTGGGAATCCCCAATTGTCAGTCATTGCTCTGGGATCCCGTGATTTTGACATC
TACCGACTATCAAACCTGATGACTGCTAAGGGGTGGAACTTGAACCAGTTGCAGTTCCCA
CCCAGTATTCATTTCTGCATCACATTACTACACGCCCGGAAACGAGTAGCTATACAATTC
CTAAAGGACATTCGAGAATCTGTCACTCAAATCATGAAGAATCCTAAAGCGAAGACCACA
GGAATGGGTGCCATCTATGGCATGGCCCAGACAACTGTTGACAGGAATATGGTTGCAGAA
TTGTCCTCAGTCTTCTTGGACAGCTTGTACAGCACCGACACTGTCACCCAGGGCAGCCAG
ATGAATGGTTCTCCAAAACCCCACTGA
Protein Properties
Number of Residues 568
Molecular Weight 63523.265
Theoretical pI 9.155
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sphingosine-1-phosphate lyase 1
MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFV
FQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQG
LSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPG
LRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQS
AHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPE
VAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKG
SSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEAT
KQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFP
PSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAE
LSSVFLDSLYSTDTVTQGSQMNGSPKPH
GenBank ID Protein 10129683
UniProtKB/Swiss-Prot ID O95470
UniProtKB/Swiss-Prot Entry Name SGPL1_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ011304
GeneCard ID SGPL1
GenAtlas ID SGPL1
HGNC ID HGNC:10817
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Nagase T, Ishikawa K, Kikuno R, Hirosawa M, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Oct 29;6(5):337-45. [PubMed:10574462 ]
  7. Van Veldhoven PP, Gijsbers S, Mannaerts GP, Vermeesch JR, Brys V: Human sphingosine-1-phosphate lyase: cDNA cloning, functional expression studies and mapping to chromosome 10q22(1). Biochim Biophys Acta. 2000 Sep 27;1487(2-3):128-34. [PubMed:11018465 ]
  8. Reiss U, Oskouian B, Zhou J, Gupta V, Sooriyakumaran P, Kelly S, Wang E, Merrill AH Jr, Saba JD: Sphingosine-phosphate lyase enhances stress-induced ceramide generation and apoptosis. J Biol Chem. 2004 Jan 9;279(2):1281-90. Epub 2003 Oct 21. [PubMed:14570870 ]
  9. Zhan X, Desiderio DM: Nitroproteins from a human pituitary adenoma tissue discovered with a nitrotyrosine affinity column and tandem mass spectrometry. Anal Biochem. 2006 Jul 15;354(2):279-89. Epub 2006 Jun 5. [PubMed:16777052 ]