You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01072
Secondary Accession Numbers
  • 6361
  • HMDBP05085
Name Guanylate cyclase soluble subunit alpha-2
Synonyms
  1. GCS-alpha-2
Gene Name GUCY1A2
Protein Type Unknown
Biological Properties
General Function Involved in phosphorus-oxygen lyase activity
Specific Function Has guanylyl cyclase on binding to the beta-1 subunit. Isoform 2 acts as a negative regulator of guanylyl cyclase activity as it forms non-functional heterodimers with the beta subunits.
Pathways
  • Adenine phosphoribosyltransferase deficiency (APRT)
  • Adenosine Deaminase Deficiency
  • Adenylosuccinate Lyase Deficiency
  • AICA-Ribosiduria
  • Azathioprine Action Pathway
  • Circadian entrainment
  • Gap junction
  • Gout or Kelley-Seegmiller Syndrome
  • Lesch-Nyhan Syndrome (LNS)
  • Long-term depression
  • Mercaptopurine Action Pathway
  • Mitochondrial DNA depletion syndrome
  • Molybdenum Cofactor Deficiency
  • Myoadenylate deaminase deficiency
  • Purine Metabolism
  • Purine metabolism
  • Purine Nucleoside Phosphorylase Deficiency
  • Salivary secretion
  • Thioguanine Action Pathway
  • Vascular smooth muscle contraction
  • Xanthine Dehydrogenase Deficiency (Xanthinuria)
  • Xanthinuria type I
  • Xanthinuria type II
Reactions
Guanosine triphosphate → Cyclic GMP + Pyrophosphate details
GO Classification
Biological Process
signal transduction
blood coagulation
positive regulation of cGMP biosynthetic process
intracellular signal transduction
Cellular Component
cytosol
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
lyase activity
iron ion binding
cyclase activity
heme binding
phosphorus-oxygen lyase activity
guanylate cyclase activity
Molecular Function
heme binding
guanylate cyclase activity
GTP binding
Process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
nucleoside monophosphate metabolic process
nucleoside monophosphate biosynthetic process
cyclic nucleotide biosynthetic process
cgmp biosynthetic process
intracellular signaling pathway
signaling
signaling pathway
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 11
Locus 11q21-q22
SNPs GUCY1A2
Gene Sequence
>2199 bp
ATGTCTCGAAGGAAGATTTCGTCCGAGTCCTTCAGCTCCCTGGGCTCCGACTACCTGGAG
ACCAGCCCGGAGGAGGAGGGGGAGTGCCCCCTGTCTAGGCTCTGCTGGAATGGCAGCCGG
AGCCCGCCCGGGCCGCTGGAGCCCAGCCCGGCCGCAGCTGCCGCTGCCGCCGCTCCGGCC
CCGACCCCGGCTGCTTCTGCCGCCGCCGCCGCTGCCACTGCCGGGGCCAGGAGGGTGCAG
CGCCGGAGGCGGGTCAACCTGGACTCGCTGGGCGAGAGCATCAGCCGCCTGACGGCGCCC
TCGCCTCAGACGATACAGCAGACTCTCAAGAGGACACTGCAGTATTATGAACATCAAGTT
ATTGGTTACAGGGATGCAGAAAAGAATTTCCACAATATCTCTAACAGATGCTCCTATGCA
GACCACTCCAATAAAGAAGAAATTGAAGATGTCTCAGGAATTCTTCAGTGTACTGCTAAT
ATACTCGGTTTGAAGTTTGAGGAAATTCAAAAAAGATTTGGTGAAGAGTTCTTTAATATA
TGCTTTCATGAGAATGAGAGAGTCCTTCGAGCTGTAGGTGGCACTTTGCAGGACTTTTTT
AACGGCTTTGATGCTTTGTTGGAACACATTAGAACTTCTTTTGGAAAACAGGCCACTCTG
GAGTCACCATCTTTCCTATGCAAAGAGCTCCCTGAAGGTACTCTCATGCTCCACTACTTC
CACCCTCACCATATTGTGGGGTTTGCAATGCTGGGGATGATTAAGGCTGCAGGAAAGAAG
ATCTATCGGCTGGATGTGGAAGTGGAACAGGTTGCAAATGAGAAGCTATGCTCTGATGTT
TCAAACCCAGGCAATTGTAGCTGTCTTACTTTCCTTATCAAAGAATGTGAAAATACTAAT
ATCATGAAGAACCTTCCACAGGGAACCTCCCAAGTTCCTGCGGACCTCAGAATTAGCATC
AACACCTTCTGTAGAGCCTTCCCTTTCCACTTGATGTTTGATCCCAGCATGTCAGTCCTT
CAGTTGGGGGAAGGTCTAAGGAAGCAGCTTCGATGTGACACTCACAAAGTGCTCAAGTTT
GAGGACTGCTTCGAGATTGTATCTCCAAAGGTTAATGCCACCTTTGAAAGGGTCCTGCTG
CGACTGTCTACCCCGTTTGTGATTAGAACCAAGCCTGAGGCTTCTGGCTCTGAAAATAAA
GACAAGGTGATGGAAGTCAAAGGACAAATGATCCATGTTCCAGAATCAAATTCCATTTTA
TTTTTGGGCTCTCCATGTGTGGACAAGTTGGATGAACTCATGGGCCGAGGGCTACATCTC
TCAGACATCCCTATCCATGATGCCACCCGAGATGTCATTTTGGTTGGTGAGCAGGCAAAG
GCCCAAGATGGGTTGAAGAAAAGGATGGATAAATTAAAGGCAACTTTAGAAAGAACTCAC
CAGGCCCTGGAAGAAGAGAAAAAGAAGACAGTGGATCTTCTATATTCTATTTTCCCTGGT
GATGTAGCCCAGCAATTATGGCAAGGGCAGCAAGTACAGGCCAGAAAGTTTGATGATGTC
ACCATGCTCTTTTCAGACATTGTTGGCTTCACAGCCATATGTGCCCAGTGTACTCCCATG
CAAGTAATCAGCATGCTGAATGAACTGTACACCAGATTTGACCACCAGTGTGGATTTTTG
GATATTTATAAGGTGGAAACAATAGGTGATGCCTACTGTGTTGCAGCAGGGCTCCACAGA
AAAAGCCTCTGCCATGCTAAACCCATTGCTCTGATGGCCTTGAAGATGATGGAACTTTCA
GAAGAGGTGCTGACACCTGATGGAAGACCGATTCAGATGAGGATAGGAATTCACTCAGGC
TCCGTGCTGGCTGGAGTTGTTGGGGTGCGAATGCCACGTTATTGCCTGTTTGGAAATAAT
GTCACACTGGCAAGCAAATTCGAGTCGGGAAGTCACCCTCGGCGCATCAATGTCAGCCCA
ACCACTTACCAATTATTAAAACGAGAAGAAAGTTTCACATTCATTCCGCGGTCTCGTGAA
GAGCTTCCAGACAACTTTCCAAAGGAAATTCCTGGGATCTGCTATTTCCTGGAGGTAAGG
ACTGGTCCAAAGCCACCAAAGCCTTCTCTTTCTTCGTCGAGAATAAAAAAGGTTTCCTAC
AACATCGGCACCATGTTCCTCCGGGAGACAAGCCTCTGA
Protein Properties
Number of Residues 732
Molecular Weight 81749.185
Theoretical pI 7.672
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Guanylate cyclase soluble subunit alpha-2
MSRRKISSESFSSLGSDYLETSPEEEGECPLSRLCWNGSRSPPGPLEPSPAAAAAAAAPA
PTPAASAAAAAATAGARRVQRRRRVNLDSLGESISRLTAPSPQTIQQTLKRTLQYYEHQV
IGYRDAEKNFHNISNRCSYADHSNKEEIEDVSGILQCTANILGLKFEEIQKRFGEEFFNI
CFHENERVLRAVGGTLQDFFNGFDALLEHIRTSFGKQATLESPSFLCKELPEGTLMLHYF
HPHHIVGFAMLGMIKAAGKKIYRLDVEVEQVANEKLCSDVSNPGNCSCLTFLIKECENTN
IMKNLPQGTSQVPADLRISINTFCRAFPFHLMFDPSMSVLQLGEGLRKQLRCDTHKVLKF
EDCFEIVSPKVNATFERVLLRLSTPFVIRTKPEASGSENKDKVMEVKGQMIHVPESNSIL
FLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTH
QALEEEKKKTVDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPM
QVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHRKSLCHAKPIALMALKMMELS
EEVLTPDGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSP
TTYQLLKREESFTFIPRSREELPDNFPKEIPGICYFLEVRTGPKPPKPSLSSSRIKKVSY
NIGTMFLRETSL
GenBank ID Protein 120659898
UniProtKB/Swiss-Prot ID P33402
UniProtKB/Swiss-Prot Entry Name GCYA2_HUMAN
PDB IDs Not Available
GenBank Gene ID BC130484
GeneCard ID GUCY1A2
GenAtlas ID GUCY1A2
HGNC ID HGNC:4684
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Harteneck C, Wedel B, Koesling D, Malkewitz J, Bohme E, Schultz G: Molecular cloning and expression of a new alpha-subunit of soluble guanylyl cyclase. Interchangeability of the alpha-subunits of the enzyme. FEBS Lett. 1991 Nov 4;292(1-2):217-22. [PubMed:1683630 ]
  4. Behrends S, Harteneck C, Schultz G, Koesling D: A variant of the alpha 2 subunit of soluble guanylyl cyclase contains an insert homologous to a region within adenylyl cyclases and functions as a dominant negative protein. J Biol Chem. 1995 Sep 8;270(36):21109-13. [PubMed:7673142 ]