Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01077
Secondary Accession Numbers
  • 6366
Name Guanylate cyclase soluble subunit beta-2
Synonyms
  1. GCS-beta-2
Gene Name GUCY1B2
Protein Type Unknown
Biological Properties
General Function Involved in phosphorus-oxygen lyase activity
Specific Function Not Available
Pathways Not Available
Reactions
Guanosine triphosphate → Cyclic GMP + Pyrophosphate details
GO Classification
Biological Process
blood coagulation
intracellular signal transduction
Cellular Component
cytoplasm
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
lyase activity
iron ion binding
cyclase activity
heme binding
phosphorus-oxygen lyase activity
guanylate cyclase activity
Molecular Function
metal ion binding
heme binding
guanylate cyclase activity
GTP binding
Process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
nucleoside monophosphate metabolic process
nucleoside monophosphate biosynthetic process
cyclic nucleotide biosynthetic process
cgmp biosynthetic process
intracellular signaling pathway
signaling
signaling pathway
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs GUCY1B2
Gene Sequence
>1854 bp
ATGTCTGGCTATGACAGGATGCTACGGACACTGGGAGGAAATCTCATGGAGTTTATTGAA
AACCTGGATGCCCTCCACAGTTACCTGGCACTCTCTTATCAGGAGATGAATGCACCATCG
TTTCGTGTGGAGAGAGGAGCAGATGGGAAAATGTTTCTCCATTACTACTCGGATAGAAGT
GGTCTGTGCCACATTGTACCAGGTATCATTGAGGCTGTGGCCAAAGACTTCTTTGATATT
GATGTAATCATGGACATTCTTGACATGAATGAAGAAGTGGAGAGGACAGGGAAGAAGGAG
CATGTTGTGTTTCTGATTGTACAGAAGGCTCACAGGAAGATGAGAAAGACNAAGCCAAAA
AGGTTACAAGACAGTCAGGGCATGGAGAGAGACCAAGAGGCCCTCCAGGCAGCTTTCCTC
AAGATGAAGGAGAAATATTTGAATGTCTCTGCTTGTCCTGTGAAAAAATCCCACTGGGAT
GTTGTGAGAAGCATAGTCATGTTTGGAAAAGGGCATCTCATGAACACCTTTGAGCCAATT
TATCCTGAGAGACTCTGGATTGAAGAGAAGACATTCTGCAACGCTTTTCCTTTCCACATT
GTATTCGATGAATCACTACAGGTGAAGCAAGCCAGAGTGAACATTCAGAAGTACGTACCA
GGACTCCAAACCCAGAATATTCAACTGGATGAGTATTTCTCCATCATTCATCCTCAAGTT
ACCTTCAACATTTTCAGCATCCGCAGATTTATCAACAGTCAATTTGTCCTGAAGACACGA
AGAGAAATGATGCCTGTAGCATGGCAAAGTCGGACTACACTCAAACTTCAAGGCCAGATG
ATCTGGATGGAGTCCATGTGGTGCATGGTGTACCTGTGCTCTCCGAAGCTCCGCAGCCTG
CAAGAGCTGGAAGAACTCAATATGCATCTTTCTGACATCGCCCCCAACGACACCACCAGG
GATCTCATCCTCCTGAACCAGCAGCGGCTGGCTGAGATAGAGCTGTCCAACCAGCTGGAA
AGGAAGAAGGAGGAGCTACAGGTCCTCTCCAAGCACTTGGCCATTGAAAAGAAGAAAACA
GAGACCTTACTTTATGCCATGCTGCCCAAACACGTGGCCAACCAGCTGAGGGAGGGCAAA
AAGGTGGCTGCAGGAGAATTTAAAAGCTGCACGATTCTTTTCAGCGATGTAGTGACATTT
ACTAACATCTGTACTGCCTGTGAACCTATACAAATAGTGAACGTGCTGAATTCCATGTAC
TCCAAGTTTGACAGATTAACCAGTGTGCACGCAGTCTATAAAGTAGAAACAATAGGAGAT
GCTTATATGGTGGTAGGAGGTGTACCAGTGCCTATTGGAAACCATGCTCAAAGAGTGGCT
AATTTTGCCTTGGGGATGAGAATTTCTGCAAAGGAAGTGACGAATCCTGTTACTGGAGAA
CCCATCCAGCTCAGAGTGGGGATCCATACTGGACCAGTCTTAGCAGATGTTGTAGGAGAC
AAGATGCCACGGTACTGCTTGTTTGGTGACACTGTGAACACAGCTTCTAGGATGGAAAGT
CATGGGCTTCCCAACAAAGTGCACCTCAGTCCCACAGCCTACAGAGCCTTGAAAAATCAA
GGGTTTAAAATCATTGAGAGGGGTGAAATTGAAGTGAAAGGTAAAGGGAGAATGACCACA
TACTTTTTGATCCAGAACTTGAATGCCACAGAGGATGAGATCATGGGGAGATCTAAAACC
CCAGTTGATCACAAGGGGTCAACACAGAAAGCATCCTTGCCCACCACCAAGCTCCAGGGC
TCAGTTCAACCATCTTGCCCTGAACACTCTTCTCTTGCATCCTGGTTATTATGA
Protein Properties
Number of Residues 617
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Guanylate cyclase soluble subunit beta-2
MSGYDRMLRTLGGNLMEFIENLDALHSYLALSYQEMNAPSFRVERGADGKMFLHYYSDRS
GLCHIVPGIIEAVAKDFFDIDVIMDILDMNEEVERTGKKEHVVFLIVQKAHRKMRKTKPK
RLQDSQGMERDQEALQAAFLKMKEKYLNVSACPVKKSHWDVVRSIVMFGKGHLMNTFEPI
YPERLWIEEKTFCNAFPFHIVFDESLQVKQARVNIQKYVPGLQTQNIQLDEYFSIIHPQV
TFNIFSIRRFINSQFVLKTRREMMPVAWQSRTTLKLQGQMIWMESMWCMVYLCSPKLRSL
QELEELNMHLSDIAPNDTTRDLILLNQQRLAEIELSNQLERKKEELQVLSKHLAIEKKKT
ETLLYAMLPKHVANQLREGKKVAAGEFKSCTILFSDVVTFTNICTACEPIQIVNVLNSMY
SKFDRLTSVHAVYKVETIGDAYMVVGGVPVPIGNHAQRVANFALGMRISAKEVTNPVTGE
PIQLRVGIHTGPVLADVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAYRALKNQ
GFKIIERGEIEVKGKGRMTTYFLIQNLNATEDEIMGRSKTPVDHKGSTQKASLPTTKLQG
SVQPSCPEHSSLASWLL
GenBank ID Protein 8081019
UniProtKB/Swiss-Prot ID O75343
UniProtKB/Swiss-Prot Entry Name GCYB2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF038499
GeneCard ID GUCY1B2
GenAtlas ID GUCY1B2
HGNC ID HGNC:4686
References
General References
  1. Behrends S, Vehse K: The beta(2) subunit of soluble guanylyl cyclase contains a human-specific frameshift and is expressed in gastric carcinoma. Biochem Biophys Res Commun. 2000 Apr 29;271(1):64-9. [PubMed:10777682 ]
  2. Behrends S, Kazmierczak B, Steenpa A, Knauf B, Bullerdiek J, Scholz H, Eiberg H: Assignment of GUCY1B2, the gene coding for the beta2 subunit of human guanylyl cyclase to chromosomal band 13q14.3 between markers D13S168 and D13S155. Genomics. 1999 Jan 1;55(1):126-7. [PubMed:9889008 ]