Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01078
Secondary Accession Numbers
  • 6367
Name Poly(A) polymerase alpha
Synonyms
  1. PAP-alpha
  2. Polynucleotide adenylyltransferase alpha
Gene Name PAPOLA
Protein Type Enzyme
Biological Properties
General Function Involved in nucleotidyltransferase activity
Specific Function Polymerase that creates the 3'-poly(A) tail of mRNA's. Also required for the endoribonucleolytic cleavage reaction at some polyadenylation sites. May acquire specificity through interaction with a cleavage and polyadenylation specificity factor (CPSF) at its C-terminus.
Pathways
  • mRNA surveillance pathway
Reactions
Adenosine triphosphate + RNA(n) → Pyrophosphate + RNA(n+1) details
GO Classification
Biological Process
mRNA splicing, via spliceosome
mRNA polyadenylation
termination of RNA polymerase II transcription
Cellular Component
cytoplasm
nucleoplasm
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleotidyltransferase activity
adenylyltransferase activity
nucleic acid binding
polynucleotide adenylyltransferase activity
rna binding
Molecular Function
manganese ion binding
magnesium ion binding
ATP binding
RNA binding
polynucleotide adenylyltransferase activity
Process
rna metabolic process
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
rna processing
biosynthetic process
rna polyadenylation
transcription
rna 3'-end processing
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location 14
Locus 14q32.31
SNPs PAPOLA
Gene Sequence
>2238 bp
ATGCCGTTTCCAGTTACAACACAGGGATCACAACAAACACAACCGCCACAGAAGCACTAT
GGCATTACTTCTCCTATCAGCTTAGCAGCCCCCAAGGAGACTGACTGCGTACTTACACAG
AAACTAATTGAGACATTGAAACCCTTTGGGGTTTTTGAAGAGGAAGAGGAACTGCAGCGC
AGGATTTTAATTTTGGGAAAACTAAATAACCTGGTAAAAGAGTGGATACGAGAAATCAGT
GAAAGCAAGAATCTTCCACAATCTGTAATTGAAAATGTTGGAGGAAAAATTTTTACATTT
GGATCTTACAGATTAGGAGTGCATACAAAAGGTGCTGATATTGATGCGTTGTGTGTTGCA
CCAAGACATGTTGATCGAAGTGACTTTTTCACCTCATTCTATGATAAGTTGAAATTACAG
GAAGAAGTAAAAGATTTAAGAGCTGTTGAAGAGGCATTCGTACCAGTTATTAAACTCTGT
TTTGATGGGATAGAGATTGATATTTTGTTTGCAAGATTAGCACTGCAGACAATTCCTGAA
GATTTGGATCTACGAGATGACAGTCTGCTAAAAAATTTAGATATAAGATGTATAAGAAGT
CTTAACGGTTGCAGGGTAACCGATGAAATTTTACATCTAGTACCAAACATTGACAACTTC
AGGTTAACTCTGAGAGCTATCAAACTATGGGCCAAACGCCACAACATCTATTCCAATATA
TTAGGTTTCCTCGGTGGTGTTTCCTGGGCTATGCTAGTAGCAAGAACTTGCCAGCTTTAT
CCAAATGCAATAGCATCAACTCTTGTACATAAATTTTTCTTGGTATTTTCTAAATGGGAA
TGGCCAAATCCAGTGCTATTGAAACAGCCTGAAGAATGCAATCTTAATTTGCCTGTATGG
GACCCAAGGGTAAACCCCAGTGATAGGTACCATCTTATGCCTATAATTACACCAGCATAC
CCACAACAGAACTCCACGTACAATGTGTCCGTTTCAACACGGATGGTCATGGTTGAGGAG
TTTAAACAAGGTCTTGCTATCACAGATGAAATTTTGCTGAGTAAGGCAGAGTGGTCCAAA
CTTTTTGAAGCTCCAAACTTCTTTCAAAAGTACAAGCATTATATTGTACTTCTAGCAAGT
GCACCAACAGAAAAACAACGCCTGGAATGGGTGGGCTTGGTGGAATCAAAAATCCGAATC
CTGGTTGGAAGCTTGGAGAAGAATGAATTTATTACACTGGCTCATGTGAATCCCCAGTCA
TTTCCAGCACCCAAAGAAAATCCCGACAAGGAAGAATTTCGCACGATGTGGGTGATTGGG
TTAGTGTTTAAAAAAACAGAAAACTCTGAAAACCTCAGTGTTGATCTCACCTATGATATT
CAGTCTTTCACAGATACAGTTTATAGGCAAGCAATAAACAGCAAGATGTTTGAGGTGGAT
ATGAAAATTGCTGCAATGCATGTAAAAAGAAAGCAACTCCATCAACTACTACCTAATCAT
GTGCTTCAGAAAAAGAAAAAGCATTCAACAGAAGGTGTCAAATTGACAGCTCTCAATGAC
AGCAGCCTCGACTTGTCTATGGACAGTGATAACAGCATGTCTGTGCCTTCACCTACTAGT
GCTACGAAGACCAGTCCATTGAACAGTTCTGGCAGCTCTCAGGGCAGAAACAGTCCTGCT
CCAGCTGTAACAGCAGCATCTGTGACCAACATACAGGCTACTGAAGTTTCTGTGCCACAA
GTAAATTCCAGTGAAAGCTCAGGGGGTACATCGAGTGAAAGCATTCCTCAAACTGCCACA
CAACCAGCCATTTCTCCACCACCAAAGCCTACGGTCTCCAGAGTTGTTTCTTCAACACGT
CTGGTAAACCCACCACCTAGATCTTCAGGAAATGCAGCAACTTCAGGAAATGCAGCAACA
AAAATACCTACTCCTATAGTAGGAGTCAAGAGGACATCCTCACCTCATAAAGAAGAGAGT
CCCAAGAAAACCAAAACAGAAGAGGATGAAACAAGTGAAGATGCTAACTGTCTTGCTTTG
AGTGGACATGATAAAACAGAAGCAAAGGAACAACTTGATACAGAGACAAGTACAACTCAA
TCAGAAACTATTCAGACAGCGGCTTCTCTGTTGGCCTCTCAGAAAACATCCAGTACAGAC
CTTTCTGATATCCCTGCTCTCCCTGCAAATCCTATTCCTGTTATCAAGAATTCAATAAAA
CTGAGATTGAATCGGTAA
Protein Properties
Number of Residues 745
Molecular Weight 32625.6
Theoretical pI 7.728
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Poly(A) polymerase alpha
MPFPVTTQGSQQTQPPQKHYGITSPISLAAPKETDCVLTQKLIETLKPFGVFEEEEELQR
RILILGKLNNLVKEWIREISESKNLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVA
PRHVDRSDFFTSFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPE
DLDLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDNFRLTLRAIKLWAKRHNIYSNI
LGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFSKWEWPNPVLLKQPEECNLNLPVW
DPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMVEEFKQGLAITDEILLSKAEWSK
LFEAPNFFQKYKHYIVLLASAPTEKQRLEWVGLVESKIRILVGSLEKNEFITLAHVNPQS
FPAPKENPDKEEFRTMWVIGLVFKKTENSENLSVDLTYDIQSFTDTVYRQAINSKMFEVD
MKIAAMHVKRKQLHQLLPNHVLQKKKKHSTEGVKLTALNDSSLDLSMDSDNSMSVPSPTS
ATKTSPLNSSGSSQGRNSPAPAVTAASVTNIQATEVSVPQVNSSESSGGTSSESIPQTAT
QPAISPPPKPTVSRVVSSTRLVNPPPRSSGNAATSGNAATKIPTPIVGVKRTSSPHKEES
PKKTKTEEDETSEDANCLALSGHDKTEAKEQLDTETSTTQSETIQTAASLLASQKTSSTD
LSDIPALPANPIPVIKNSIKLRLNR
GenBank ID Protein 32490557
UniProtKB/Swiss-Prot ID P51003
UniProtKB/Swiss-Prot Entry Name PAPOA_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_032632.3
GeneCard ID PAPOLA
GenAtlas ID PAPOLA
HGNC ID HGNC:14981
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  5. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Thuresson AC, Astrom J, Astrom A, Gronvik KO, Virtanen A: Multiple forms of poly(A) polymerases in human cells. Proc Natl Acad Sci U S A. 1994 Feb 1;91(3):979-83. [PubMed:8302877 ]
  8. Dettwiler S, Aringhieri C, Cardinale S, Keller W, Barabino SM: Distinct sequence motifs within the 68-kDa subunit of cleavage factor Im mediate RNA binding, protein-protein interactions, and subcellular localization. J Biol Chem. 2004 Aug 20;279(34):35788-97. Epub 2004 May 28. [PubMed:15169763 ]
  9. Kaufmann I, Martin G, Friedlein A, Langen H, Keller W: Human Fip1 is a subunit of CPSF that binds to U-rich RNA elements and stimulates poly(A) polymerase. EMBO J. 2004 Feb 11;23(3):616-26. Epub 2004 Jan 29. [PubMed:14749727 ]