You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01097
Secondary Accession Numbers
  • 6386
Name Uridine diphosphate glucose pyrophosphatase
Synonyms
  1. Nucleoside diphosphate-linked moiety X motif 14
  2. Nudix motif 14
  3. UDPG pyrophosphatase
  4. UGPPase
Gene Name NUDT14
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
Specific Function Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and ADP-ribose to ribose 5-phosphate and AMP. The physiological substrate is probably UDP-glucose. Poor activity on other substrates such as ADP-glucose, CDP-glucose, GDP-glucose and GDP-mannose.
Pathways Not Available
Reactions
UDP-sugar + Water → Uridine 5'-monophosphate + alpha-D-aldose 1-phosphate details
GO Classification
Cellular Component
cytoplasm
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
Molecular Function
UDP-sugar diphosphatase activity
metal ion binding
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 14
Locus 14q32.33
SNPs NUDT14
Gene Sequence
>669 bp
ATGGAGCGCATCGAGGGGGCGTCCGTGGGCCGCTGCGCCGCCTCACCCTACCTGCGGCCG
CTCACGCTGCATTACCGCCAGAATGGTGCCCAGAAGTCCTGGGACTTCATGAAGACGCAT
GACAGCGTGACCGTTCTCTTATTCAACTCTTCTCGGAGGAGCCTGGTGTTGGTGAAGCAG
TTCCGGCCAGCTGTGTATGCGGGTGAGGTGGAGCGCCGCTTCCCAGGGTCCCTAGCAGCT
GTAGACCAGGACGGGCCTCGGGAGCTACAGCCAGCCCTGCCCGGCTCAGCGGGGGTGACA
GTTGAGCTGTGTGCCGGCCTCGTGGACCAGCCTGGGCTCTCGCTGGAGGAAGTGGCTTGC
AAGGAGGCTTGGGAGGAGTGTGGCTACCACTTGGCCCCCTCTGATCTGCGCCGGGTCGCC
ACATACTGGTCTGGAGTGGGACTGACTGGCTCCAGACAGACCATGTTCTACACAGAGGTG
ACAGATGCCCAGCGTAGCGGTCCAGGTGGGGGCCTGGTGGAGGAGGGTGAGCTCATTGAG
GTGGTGCACCTGCCCCTGGAAGGCGCCCAGGCCTTTGCAGACGACCCGGACATCCCCAAG
ACCCTCGGCGTCATCTTTGGTGTCTCATGGTTCCTCAGCCAGGTGGCCCCCAACCTGGAT
CTCCAGTGA
Protein Properties
Number of Residues 222
Molecular Weight 24118.085
Theoretical pI 5.049
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Uridine diphosphate glucose pyrophosphatase
MERIEGASVGRCAASPYLRPLTLHYRQNGAQKSWDFMKTHDSVTVLLFNSSRRSLVLVKQ
FRPAVYAGEVERRFPGSLAAVDQDGPRELQPALPGSAGVTVELCAGLVDQPGLSLEEVAC
KEAWEECGYHLAPSDLRRVATYWSGVGLTGSRQTMFYTEVTDAQRSGPGGGLVEEGELIE
VVHLPLEGAQAFADDPDIPKTLGVIFGVSWFLSQVAPNLDLQ
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O95848
UniProtKB/Swiss-Prot Entry Name NUD14_HUMAN
PDB IDs
GenBank Gene ID AB087802
GeneCard ID NUDT14
GenAtlas ID NUDT14
HGNC ID HGNC:20141
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121 ]
  3. Deng Y, Madan A, Banta AB, Friedman C, Trask BJ, Hood L, Li L: Characterization, chromosomal localization, and the complete 30-kb DNA sequence of the human Jagged2 (JAG2) gene. Genomics. 2000 Jan 1;63(1):133-8. [PubMed:10662552 ]
  4. Yagi T, Baroja-Fernandez E, Yamamoto R, Munoz FJ, Akazawa T, Hong KS, Pozueta-Romero J: Cloning, expression and characterization of a mammalian Nudix hydrolase-like enzyme that cleaves the pyrophosphate bond of UDP-glucose. Biochem J. 2003 Mar 1;370(Pt 2):409-15. [PubMed:12429023 ]