You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01102
Secondary Accession Numbers
  • 6391
Name Beta-1,3-galactosyltransferase 4
Synonyms
  1. Beta-1,3-GalTase 4
  2. Beta3Gal-T4
  3. Beta3GalT4
  4. Gal-T2
  5. GalT4
  6. Ganglioside galactosyltransferase
  7. UDP-galactose:beta-N-acetyl-galactosamine-beta-1,3-galactosyltransferase
  8. b3Gal-T4
Gene Name B3GALT4
Protein Type Enzyme
Biological Properties
General Function Involved in galactosyltransferase activity
Specific Function Involved in GM1/GD1B/GA1 ganglioside biosynthesis.
Pathways
  • Glycosphingolipid biosynthesis - ganglio series
  • Other types of O-glycan biosynthesis
  • protein glycosylation
Reactions
Uridine diphosphategalactose + an N-acetyl-beta-D-galactosaminyl-(1->4)-(alpha-N-acetylneuraminyl-(2->3))-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-ceramide → Uridine 5'-diphosphate + a beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)-(alpha-N-acetylneuraminyl-(2->3))-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-ceramide details
UDP-D-galactose + GM2 → UDP + GM1 details
UDP-D-galactose + GD2 → UDP + GD1b details
UDP-D-galactose + GT2 → UDP + GT1c details
UDP-D-galactose + GA2 → UDP + GA1 details
GO Classification
Biological Process
protein glycosylation
Cellular Component
integral to membrane
Golgi membrane
Component
membrane
cell part
Function
galactosyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring hexosyl groups
transferase activity, transferring glycosyl groups
Molecular Function
ganglioside galactosyltransferase activity
UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
protein amino acid glycosylation
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 6
Locus 6p21.3
SNPs B3GALT4
Gene Sequence
>1137 bp
ATGCAGCTCAGGCTCTTCCGGCGCCTCCTTCTCGCCGCTTTGCTGCTGGTGATCGTCTGG
ACCCTCTTCGGGCCTTCGGGGTTGGGGGAGGAGCTGCTGAGCCTCTCACTAGCCTCCCTG
CTCCCAGCCCCCGCCTCACCGGGGCCGCCCCTGGCCCTGCCCCGCCTCTTGATCCCCAAC
CAGGAAGCTTGCAGTGGTCCCGGGGCCCCTCCCTTCCTGCTCATCCTGGTGTGCACGGCT
CCGGAGAACCTGAACCAGAGAAACGCCATTCGGGCTTCGTGGGGCGGGCTGCGCGAGGCC
CGGGGGCTCAGGGTACAGACGCTATTCTTGCTGGGAGAGCCGAACGCACAGCACCCCGTG
TGGGGTTCCCAGGGGAGTGACCTGGCCTCGGAGTCAGCAGCCCAGGGGGATATCTTGCAG
GCCGCCTTCCAGGACTCCTACCGCAACCTCACCCTAAAGACCCTCAGCGGGCTGAACTGG
GCTGAGAAACACTGCCCCATGGCCCGATACGTCCTCAAGACGGACGATGATGTGTATGTC
AACGTCCCTGAACTGGTATCAGAGCTGGTCTTGCGAGGGGGCCGTTGGGGGCAATGGGAG
AGAAGCACGGAACCCCAGAGAGAGGCTGAGCAGGAAGGAGGCCAGGTTTTGCACAGCGAG
GAAGTGCCTCTTCTGTACTTGGGCCGGGTGCACTGGCGCGTGAACCCCTCTCGGACACCG
GGGGGCAGGCACCGCGTATCAGAGGAGCAGTGGCCTCACACCTGGGGCCCCTTTCCACCC
TATGCCTCAGGCACGGGGTATGTGCTGTCAGCGTCTGCTGTGCAGCTCATTCTCAAGGTG
GCCAGCCGGGCACCCCTTCTCCCATTAGAGGATGTCTTTGTGGGGGTAAGTGCCCGACGA
GGAGGCCTCGCCCCAACACAGTGTGTCAAGCTGGCTGGTGCCACCCACTACCCGCTAGAC
CGGTGCTGCTATGGGAAATTCCTGCTGACGTCCCACAGGCTGGACCCCTGGAAGATGCAG
GAAGCCTGGAAGCTGGTGGGTGGCTCTGACGGGGAAAGGACTGCGCCCTTTTGCTCCTGG
TTCCAGGGAGTCCTGGGCATCCTGCGGTGTCGAGCAATAGCCTGGCTTCAGAGCTGA
Protein Properties
Number of Residues 378
Molecular Weight 41536.435
Theoretical pI 8.308
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Beta-1,3-galactosyltransferase 4
MQLRLFRRLLLAALLLVIVWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPN
QEACSGPGAPPFLLILVCTAPENLNQRNAIRASWGGLREARGLRVQTLFLLGEPNAQHPV
WGSQGSDLASESAAQGDILQAAFQDSYRNLTLKTLSGLNWAEKHCPMARYVLKTDDDVYV
NVPELVSELVLRGGRWGQWERSTEPQREAEQEGGQVLHSEEVPLLYLGRVHWRVNPSRTP
GGRHRVSEEQWPHTWGPFPPYASGTGYVLSASAVQLILKVASRAPLLPLEDVFVGVSARR
GGLAPTQCVKLAGATHYPLDRCCYGKFLLTSHRLDPWKMQEAWKLVGGSDGERTAPFCSW
FQGVLGILRCRAIAWLQS
GenBank ID Protein 6683014
UniProtKB/Swiss-Prot ID O96024
UniProtKB/Swiss-Prot Entry Name B3GT4_HUMAN
PDB IDs Not Available
GenBank Gene ID AB026730
GeneCard ID B3GALT4
GenAtlas ID B3GALT4
HGNC ID HGNC:919
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Amado M, Almeida R, Carneiro F, Levery SB, Holmes EH, Nomoto M, Hollingsworth MA, Hassan H, Schwientek T, Nielsen PA, Bennett EP, Clausen H: A family of human beta3-galactosyltransferases. Characterization of four members of a UDP-galactose:beta-N-acetyl-glucosamine/beta-nacetyl-galactosamine beta-1,3-galactosyltransferase family. J Biol Chem. 1998 May 22;273(21):12770-8. [PubMed:9582303 ]
  4. Shiina T, Kikkawa E, Iwasaki H, Kaneko M, Narimatsu H, Sasaki K, Bahram S, Inoko H: The beta-1,3-galactosyltransferase-4 (B3GALT4) gene is located in the centromeric segment of the human MHC class II region. Immunogenetics. 2000 Jan;51(1):75-8. [PubMed:10663566 ]