Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01121
Secondary Accession Numbers
  • 6415
Name cGMP-dependent protein kinase 1
Synonyms
  1. cGK 1
  2. cGK1
  3. cGKI
  4. cGMP-dependent protein kinase I
Gene Name PRKG1
Protein Type Enzyme
Biological Properties
General Function Involved in protein serine/threonine kinase activity
Specific Function Phosphorylates PPP1R12A
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
cyclic nucleotide-dependent protein kinase activity
cgmp-dependent protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 10q11.2
SNPs PRKG1
Gene Sequence
>2016 bp
ATGAGCGAGCTAGAGGAAGACTTTGCCAAGATTCTCATGCTCAAGGAGGAGAGGATCAAA
GAGCTGGAGAAGCGGCTGTCAGAGAAGGAGGAAGAAATTCAGGAGCTGAAGAGGAAACTC
CACAAATGCCAGTCGGTGCTCCCAGTGCCCTCGACCCACATCGGCCCCCGGACCACCCGG
GCGCAGGGCATCTCGGCCGAGCCGCAGACGTACAGGTCCTTCCACGACCTCCGACAGGCA
TTCCGGAAGTTCACCAAGTCCGAAAGGTCCAAGGATCTTATAAAGGAAGCTATCCTTGAC
AATGACTTTATGAAGAACTTGGAGCTGTCGCAGATCCAGGAGATTGTGGATTGTATGTAC
CCGGTGGAGTATGGCAAGGACAGTTGCATCATCAAAGAAGGAGACGTGGGGTCACTGGTG
TATGTCATGGAAGATGGTAAGGTTGAAGTTACAAAAGAAGGTGTGAAGTTGTGTACCATG
GGTCCAGGAAAAGTGTTTGGGGAATTGGCTATTCTTTACAACTGTACCCGGACAGCGACC
GTCAAGACTCTTGTAAATGTAAAACTCTGGGCCATTGATCGACAATGTTTTCAAACAATA
ATGATGAGGACAGGACTCATCAAGCATACCGAGTATATGGAATTTTTAAAAAGCGTTCCA
ACATTCCAGAGCCTTCCTGAAGAGATCCTCAGCAAGCTTGCTGATGTCCTTGAAGAGACC
CACTATGAAAATGGAGAATATATTATCAGGCAAGGTGCAAGAGGGGACACCTTCTTTATC
ATCAGCAAAGGAACGGTAAATGTCACTCGTGAAGACTCACCGAGTGAAGACCCAGTCTTT
CTTAGAACTTTAGGAAAAGGAGACTGGTTTGGAGAGAAAGCCTTGCAGGGGGAAGATGTG
AGAACAGCAAACGTAATTGCTGCAGAAGCTGTAACCTGCCTTGTGATTGACAGAGACTCT
TTTAAACATTTGATTGGAGGGCTGGATGATGTTTCTAATAAAGCATATGAAGATGCAGAA
GCTAAAGCAAAATATGAAGCTGAAGCGGCTTTCTTCGCCAACCTGAAGCTGTCTGATTTC
AACATCATTGATACCCTTGGAGTTGGAGGTTTCGGACGAGTAGAACTGGTCCAGTTGAAA
AGTGAAGAATCCAAAACGTTTGCAATGAAGATTCTCAAGAAACGTCACATTGTGGACACA
AGACAGCAGGAGCACATCCGCTCAGAGAAGCAGATCATGCAGGGGGCTCATTCCGATTTC
ATAGTGAGACTGTACAGAACATTTAAGGACAGCAAATATTTGTATATGTTGATGGAAGCT
TGTCTAGGTGGAGAGCTCTGGACCATTCTCAGGGATAGAGGTTCGTTTGAAGATTCTACA
ACCAGATTTTACACAGCATGTGTGGTAGAAGCTTTTGCCTATCTGCATTCCAAAGGAATC
ATTTACAGGGACCTCAAGCCAGAAAATCTCATCCTAGATCACCGAGGTTATGCCAAACTG
GTTGATTTTGGCTTTGCAAAGAAAATAGGATTTGGAAAGAAAACATGGACTTTTTGTGGG
ACTCCAGAGTATGTAGCCCCAGAGATCATCCTGAACAAAGGCCATGACATTTCAGCCGAC
TACTGGTCACTGGGAATCCTAATGTATGAACTCCTGACTGGCAGCCCACCTTTCTCAGGC
CCAGATCCTATGAAAACCTATAACATCATATTGAGGGGGATTGACATGATAGAATTTCCA
AAGAAGATTGCCAAAAATGCTGCTAATTTAATTAAAAAACTATGCAGGGACAATCCATCA
GAAAGATTAGGGAATTTGAAAAATGGAGTAAAAGACATTCAAAAGCACAAATGGTTTGAG
GGCTTTAACTGGGAAGGCTTAAGAAAAGGTACCTTGACACCTCCTATAATACCAAGTGTT
GCATCACCCACAGACACAAGTAATTTTGACAGTTTCCCTGAGGACAACGATGAACCACCA
CCTGATGACAACTCAGGATGGGATATAGACTTCTAA
Protein Properties
Number of Residues 671
Molecular Weight 76363.8
Theoretical pI 5.87
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>cGMP-dependent protein kinase 1
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPP
PDDNSGWDIDF
GenBank ID Protein 148612818
UniProtKB/Swiss-Prot ID Q13976
UniProtKB/Swiss-Prot Entry Name KGP1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001098512.1
GeneCard ID PRKG1
GenAtlas ID PRKG1
HGNC ID HGNC:9414
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  3. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  4. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  5. Sandberg M, Natarajan V, Ronander I, Kalderon D, Walter U, Lohmann SM, Jahnsen T: Molecular cloning and predicted full-length amino acid sequence of the type I beta isozyme of cGMP-dependent protein kinase from human placenta. Tissue distribution and developmental changes in rat. FEBS Lett. 1989 Sep 25;255(2):321-9. [PubMed:2792381 ]
  6. Orstavik S, Natarajan V, Tasken K, Jahnsen T, Sandberg M: Characterization of the human gene encoding the type I alpha and type I beta cGMP-dependent protein kinase (PRKG1). Genomics. 1997 Jun 1;42(2):311-8. [PubMed:9192852 ]
  7. Tamura N, Itoh H, Ogawa Y, Nakagawa O, Harada M, Chun TH, Suga S, Yoshimasa T, Nakao K: cDNA cloning and gene expression of human type Ialpha cGMP-dependent protein kinase. Hypertension. 1996 Mar;27(3 Pt 2):552-7. [PubMed:8613202 ]
  8. Surks HK, Mochizuki N, Kasai Y, Georgescu SP, Tang KM, Ito M, Lincoln TM, Mendelsohn ME: Regulation of myosin phosphatase by a specific interaction with cGMP- dependent protein kinase Ialpha. Science. 1999 Nov 19;286(5444):1583-7. [PubMed:10567269 ]
  9. Wooldridge AA, MacDonald JA, Erdodi F, Ma C, Borman MA, Hartshorne DJ, Haystead TA: Smooth muscle phosphatase is regulated in vivo by exclusion of phosphorylation of threonine 696 of MYPT1 by phosphorylation of Serine 695 in response to cyclic nucleotides. J Biol Chem. 2004 Aug 13;279(33):34496-504. Epub 2004 Jun 11. [PubMed:15194681 ]
  10. Antl M, von Bruhl ML, Eiglsperger C, Werner M, Konrad I, Kocher T, Wilm M, Hofmann F, Massberg S, Schlossmann J: IRAG mediates NO/cGMP-dependent inhibition of platelet aggregation and thrombus formation. Blood. 2007 Jan 15;109(2):552-9. Epub 2006 Sep 21. [PubMed:16990611 ]
  11. Lee E, Hayes DB, Langsetmo K, Sundberg EJ, Tao TC: Interactions between the leucine-zipper motif of cGMP-dependent protein kinase and the C-terminal region of the targeting subunit of myosin light chain phosphatase. J Mol Biol. 2007 Nov 9;373(5):1198-212. Epub 2007 Aug 25. [PubMed:17904578 ]
  12. Sharma AK, Zhou GP, Kupferman J, Surks HK, Christensen EN, Chou JJ, Mendelsohn ME, Rigby AC: Probing the interaction between the coiled coil leucine zipper of cGMP-dependent protein kinase Ialpha and the C terminus of the myosin binding subunit of the myosin light chain phosphatase. J Biol Chem. 2008 Nov 21;283(47):32860-9. doi: 10.1074/jbc.M804916200. Epub 2008 Sep 9. [PubMed:18782776 ]
  13. Schnell JR, Zhou GP, Zweckstetter M, Rigby AC, Chou JJ: Rapid and accurate structure determination of coiled-coil domains using NMR dipolar couplings: application to cGMP-dependent protein kinase Ialpha. Protein Sci. 2005 Sep;14(9):2421-8. [PubMed:16131665 ]