Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01125
Secondary Accession Numbers
  • 6419
Name cGMP-dependent protein kinase 2
Synonyms
  1. cGK 2
  2. cGK2
  3. cGKII
  4. cGMP-dependent protein kinase II
Gene Name PRKG2
Protein Type Enzyme
Biological Properties
General Function Involved in protein serine/threonine kinase activity
Specific Function ATP + a protein = ADP + a phosphoprotein
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
cyclic nucleotide-dependent protein kinase activity
cgmp-dependent protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:4
Locus 4q13.1-q21.1
SNPs PRKG2
Gene Sequence
>2289 bp
ATGGGAAATGGTTCAGTGAAACCTAAACATTCTAAGCACCCAGATGGACACTCTGGGAAC
CTCACCACTGATGCTCTGCGGAACAAGGTGACAGAGCTGGAGAGAGAGTTGAGGAGGAAG
GATGCTGAGATCCAGGAGCGGGAGTACCATTTGAAGGAGCTGCGGGAGCATGGTTCGAAG
CAGACTGTGGCCATTGCTGAACTCACAGAGGAGCTCCAGAACAAGTGCATCCAGCTGAAC
AAGCTGCAGGATGTGGTGCATATGCAGGGAGGAAGCCCGCTTCAGGCCTCTCCAGATAAA
GTGCCTCTTGAGGTCCACCGGAAGACCTCTGGATTGGTCTCTCTCCATAGCAGGAGGGGA
GCAAAGGCTGGCGTGTCTGCTGAGCCAACAACCCGGACCTATGACCTGAACAAACCCCCT
GAATTTTCCTTTGAGAAAGCAAGAGTCAGAAAAGACTCCAGTGAGAAGAAGCTCATTACA
GATGCCCTTAATAAAAATCAGTTTCTGAAAAGACTGGATCCTCAGCAGATCAAAGACATG
GTGGAATGCATGTATGGGAGAAACTATCAGCAAGGGAGTTACATTATTAAGCAAGGAGAA
CCAGGAAACCATATCTTTGTGCTGGCAGAGGGTCGACTAGAGGTGTTCCAAGGGGAGAAA
TTGCTGTCCTCCATCCCTATGTGGACCACATTTGGGGAGCTTGCCATTTTATACAATTGT
ACAAGGACTGCCTCTGTGAAAGCTATTACCAATGTTAAAACATGGGCACTAGATCGAGAG
GTATTCCAGAATATAATGAGGAGGACAGCCCAAGCTAGAGATGAACAATACAGAAACTTC
CTCAGAAGTGTATCCTTGCTGAAGAATTTACCTGAAGATAAATTAACCAAGATCATTGAC
TGCTTGGAAGTGGAATACTATGACAAAGGAGATTACATCATTAGAGAGGGCGAGGAAGGA
AGTACCTTTTTCATTTTGGCAAAAGGAAAGGTAAAAGTAACACAGAGCACAGAAGGCCAT
GATCAACCACAGCTGATAAAAACACTGCAGAAAGGAGAATACTTTGGAGAAAAAGCTCTT
ATCAGTGATGATGTCAGGTCAGCTAACATTATTGCTGAAGAAAATGATGTTGCATGCCTG
GTTATAGATCGAGAAACATTCAACCAAACTGTCGGTACATTTGAAGAGCTGCAAAAATAC
CTTGAAGGATATGTGGCAAACCTGAACCGTGATGATGAAAAAAGACATGCGAAGCGGTCC
ATGTCTAACTGGAAGCTGTCCAAAGCACTCTCTCTGGAAATGATTCAGCTGAAGGAGAAG
GTGGCCAGATTTTCCTCATCATCCCCATTCCAGAACCTTGAGATTATTGCAACACTGGCC
GTTGGTGGGTTCGGAAGAGTTGAGCTTGTTAAAGTAAAAAATGAGAATGTTGCTTTTGCT
ATGAAGTGTATAAGGAAGAAGCACATAGTTGACACCAAGCAGCAGGAGCATGTCTACTCA
GAGAAGAGGATCCTAGAGGAGCTGTGCTCTCCATTCATTGTGAAATTATATCGTACTTTC
AAGGACAATAAGTATGTATACATGCTTCTGGAGGCCTGCTTAGGTGGGGAGCTCTGGAGT
ATATTAAGGGACAGAGGCAGCTTTGATGAACCCACCTCCAAATTCTGCGTTGCTTGTGTG
ACAGAAGCATTTGATTACCTGCATCGACTAGGTATTATCTACAGAGACTTGAAACCAGAA
AACTTAATTCTAGATGCTGAGGGTTACCTTAAATTGGTTGACTTTGGATTTGCGAAGAAA
ATAGGGTCTGGACAGAAAACATGGACATTCTGTGGGACTCCAGAATATGTAGCTCCTGAA
GTCATTCTCAACAAGGGACATGACTTCAGTGTGGATTTCTGGTCACTGGGAATTCTAGTG
TATGAGCTCCTAACGGGCAACCCACCCTTTTCTGGGGTTGACCAAATGATGACCTACAAT
TTGATTCTCAAAGGAATTGAAAAAATGGATTTTCCCAGGAAGATAACACGACGACCTGAG
GATTTGATTCGGAGGCTTTGCAGGCAAAATCCAACAGAAAGGCTGGGAAATCTGAAGAAT
GGAATAAATGACATTAAGAAACACAGGTGGTTAAATGGTTTTAATTGGGAGGGACTGAAA
GCACGGAGCCTTCCATCACCTTTGCAAAGAGAGCTCAAGGGACCCATAGATCACAGCTAC
TTTGACAAATATCCTCCTGAAAAGGGAATGCCTCCAGATGAGCTATCAGGCTGGGATAAA
GACTTCTGA
Protein Properties
Number of Residues 762
Molecular Weight 87431.5
Theoretical pI 8.67
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>cGMP-dependent protein kinase 2
MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSK
QTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS
MSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFA
MKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWS
ILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKK
IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYN
LILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLK
ARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF
GenBank ID Protein 1906312
UniProtKB/Swiss-Prot ID Q13237
UniProtKB/Swiss-Prot Entry Name KGP2_HUMAN
PDB IDs Not Available
GenBank Gene ID D70899
GeneCard ID PRKG2
GenAtlas ID PRKG2
HGNC ID HGNC:9416
References
General References
  1. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  2. Orstavik S, Solberg R, Tasken K, Nordahl M, Altherr MR, Hansson V, Jahnsen T, Sandberg M: Molecular cloning, cDNA structure, and chromosomal localization of the human type II cGMP-dependent protein kinase. Biochem Biophys Res Commun. 1996 Mar 27;220(3):759-65. [PubMed:8607838 ]
  3. Fujii M, Ogata T, Takahashi E, Yamada K, Nakabayashi K, Oishi M, Ayusawa D: Expression of the human cGMP-dependent protein kinase II gene is lost upon introduction of SV40 T antigen or immortalization in human cells. FEBS Lett. 1995 Nov 20;375(3):263-7. [PubMed:7498513 ]
  4. Witczak O, Orstavik S, Natarajan V, Frengen E, Jahnsen T, Sandberg M: Characterization of the gene encoding the human type II cGMP-dependent protein kinase. Biochem Biophys Res Commun. 1998 Apr 7;245(1):113-9. [PubMed:9535793 ]
  5. Zhan X, Desiderio DM: The human pituitary nitroproteome: detection of nitrotyrosyl-proteins with two-dimensional Western blotting, and amino acid sequence determination with mass spectrometry. Biochem Biophys Res Commun. 2004 Dec 24;325(4):1180-6. [PubMed:15555551 ]