You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01148
Secondary Accession Numbers
  • 6444
Name Receptor-interacting serine/threonine-protein kinase 3
Synonyms
  1. RIP-3
  2. RIP-like protein kinase 3
  3. Receptor-interacting protein 3
Gene Name RIPK3
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function Promotes apoptosis
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Cytoplasm (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 14q11.2
SNPs RIPK3
Gene Sequence
>1557 bp
ATGTCGTGCGTCAAGTTATGGCCCAGCGGTGCCCCCGCCCCCTTGGTGTCCATCGAGGAA
CTGGAGAACCAGGAGCTCGTCGGCAAAGACGGGTTCGGCACAGTGTTCCGGGCGCAACAT
AGGAAGTGGGGCTACGATGTGGCGGTCAAGATCGTAAACTCGAAGGCGATATCCAGGGAG
GTCAAGGCCATGGCAAGTCTGGATAACGAATTCGTGTTGCGCCTAGAAGGGGTTATCGAG
AAGGTGAACTGGGACCAAGATCCCAAGCCGGCTCTGGTGACTAAATTCATGGAGAACGGC
TCCCTGTCGGGGCTGCTGCAGTCCCAGTGCCCTCGGCCCTGGCCGCTCCTTTGCCGCCTG
CTGAAAGAAGTGGTGCTTGGGATGTTTTACCTGCACGACCAGAACCCGGTGCTCCTGCAC
CGGGACCTCAAGCCATCCAACGTCCTGCCGGACCCAGAGCTGCACGTCAAGCTGGCAGAT
TTTGGCCTGTCCACATTTCAGGGAGGCTCACAGTCAGGGACAGGGTCCGGGGAGCCAGGG
GGCACCCTGGGCTACTTGGCCCCAGAACTGTTTGTTAACGTAAACCGGAAGGCCTCCACA
GCCAGTGACGTCTACAGCTTCGGGATCCTAATGTGGGCAGTGCTTGCTGGAAGAGAAGTT
GAGTTGCCAACCGAACCATCACTCGTGTACGAAGCAGTGTGCAACAGGCAGAACCGGCCT
TCATTGGCTGAGCTGCCCCAAGCCGGGCCTGAGACTCCCGGCTTAGAAGGACTGAAGGAG
CTAATGCAGCTCTGCTGGAGCAGTGAGCCCAAGGACAGACCCTCCTTCCAGGAATGCCTA
CCAAAAACTGATGAAGTCTTCCAGATGGTGGAGAACAATATGAATGCTGCTGTCTCCACG
GTAAAGGATTTCCTGTCTCAGCTCAAGAGCAGCAATAGGAGATTTTCTATCCCAGAGTCA
GGCCAAGGAGGGACAGAAATGGATGGCTTTAGGAGAACCATAGAAAACCAGCACTCTCGT
AATGATGTCATGGTTTCTGAGTGGCTAAACAAACTGAATCTAGAGGAGCCTCCCAGCTCT
GTTCCTAAAAAATGCCCGAGCCTTACCAAGAGGAGCAGGGCACAAGAGGAGCAGGTTCCA
CAAGCCTGGACAGCAGGCACATCTTCAGATTCGATGGCCCAACCTCCCCAGACTCCAGAG
ACCTCAACTTTCAGAAACCAGATGCCCAGCCCTACCTCAACTGGAACACCAAGTCCTGGA
CCCCGAGGGAATCAGGGGGCTGAGAGACAAGGCATGAACTGGTCCTGCAGGACCCCGGAG
CCAAATCCAGTAACAGGGCGACCGCTCGTTAACATATACAACTGCTCTGGGGTGCAAGTT
GGAGACAACAACTACTTGACTATGCAACAGACAACTGCCTTGCCCACATGGGGCTTGGCA
CCTTCGGGCAAGGGGAGGGGCTTGCAGCACCCCCCACCAGTAGGTTCGCAAGAAGGCCCT
AAAGATCCTGAAGCCTGGAGCAGGCCACAGGGTTGGTATAATCATAGCGGGAAATAA
Protein Properties
Number of Residues 518
Molecular Weight 56886.9
Theoretical pI 6.41
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Receptor-interacting serine/threonine-protein kinase 3
MSCVKLWPSGAPAPLVSIEELENQELVGKGGFGTVFRAQHRKWGYDVAVKIVNSKAISRE
VKAMASLDNEFVLRLEGVIEKVNWDQDPKPALVTKFMENGSLSGLLQSQCPRPWPLLCRL
LKEVVLGMFYLHDQNPVLLHRDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTGSGEPG
GTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAGREVELPTEPSLVYEAVCNRQNRP
SLAELPQAGPETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVFQMVENNMNAAVST
VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSS
VPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG
PRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLA
PSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK
GenBank ID Protein 5059425
UniProtKB/Swiss-Prot ID Q9Y572
UniProtKB/Swiss-Prot Entry Name RIPK3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF156884
GeneCard ID RIPK3
GenAtlas ID RIPK3
HGNC ID HGNC:10021
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121 ]
  4. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  5. Yu PW, Huang BC, Shen M, Quast J, Chan E, Xu X, Nolan GP, Payan DG, Luo Y: Identification of RIP3, a RIP-like kinase that activates apoptosis and NFkappaB. Curr Biol. 1999 May 20;9(10):539-42. [PubMed:10339433 ]
  6. Sun X, Lee J, Navas T, Baldwin DT, Stewart TA, Dixit VM: RIP3, a novel apoptosis-inducing kinase. J Biol Chem. 1999 Jun 11;274(24):16871-5. [PubMed:10358032 ]
  7. Yang Y, Hu W, Feng S, Ma J, Wu M: RIP3 beta and RIP3 gamma, two novel splice variants of receptor-interacting protein 3 (RIP3), downregulate RIP3-induced apoptosis. Biochem Biophys Res Commun. 2005 Jun 24;332(1):181-7. [PubMed:15896315 ]