You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01151
Secondary Accession Numbers
  • 6447
Name Death-associated protein kinase 2
Synonyms
  1. DAP kinase 2
  2. DAP-kinase-related protein 1
  3. DRP-1
Gene Name DAPK2
Protein Type Unknown
Biological Properties
General Function Involved in protein kinase activity
Specific Function Calcium/calmodulin-dependent serine/threonine kinase which acts as a positive regulator of apoptosis
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 15q22.31
SNPs DAPK2
Gene Sequence
>1113 bp
ATGTTCCAGGCCTCAATGAGGAGTCCAAACATGGAGCCATTCAAGCAGCAGAAGGTGGAG
GACTTTTATGACATCGGAGAGGAGCTGGGGAGTGGCCAGTTTGCCATCGTGAAGAAGTGC
CGGGAGAAGAGCACGGGGCTTGAGTATGCAGCCAAGTTCATCAAGAAGCGGCAGAGCCGG
GCGAGCCGGCGCGGTGTGAGCCGGGAGGAGATCGAGCGGGAGGTGAGCATCCTGCGGCAG
GTGCTGCACCACAATGTCATCACGCTGCACGACGTCTATGAGAACCGCACCGACGTGGTG
CTCATCCTTGAGCTAGTGTCTGGAGGAGAGCTCTTCGATTTCCTGGCCCAGAAGGAGTCA
CTGAGTGAGGAGGAGGCCACCAGCTTCATTAAGCAGATCCTGGATGGGGTGAACTACCTT
CACACAAAGAAAATTGCTCACTTTGATCTCAAGCCAGAAAACATTATGTTGTTAGACAAG
AATATTCCCATTCCACACATCAAGCTGATTGACTTTGGTCTGGCTCACGAAATAGAAGAT
GGAGTTGAATTTAAGAATATTTTTGGGACGCCGGAATTTGTTGCTCCAGAAATTGTGAAC
TACGAGCCCCTGGGTCTGGAGGCTGACATGTGGAGCATAGGCGTCATCACCTACATCCTC
TTAAGTGGAGCATCCCCTTTCCTGGGAGACACGAAGCAGGAAACACTGGCAAATATCACA
GCAGTGAGTTACGACTTTGATGAGGAATTCTTCAGCCAGACGAGCGAGCTGGCCAAGGAC
TTTATTCGGAAGCTTCTGGTTAAAGAGACCCGGAAACGGCTCACAATCCAAGAGGCTCTC
AGACACCCCTGGATCACGCCGGTGGACAACCAGCAAGCCATGGTGCGCAGGGAGTCTGTG
GTCAATCTGGAGAACTTCAGGAAGCAGTATGTCCGCAGGCGGTGGAAGCTTTCCTTCAGC
ATCGTGTCCCTGTGCAACCACCTCACCCGCTCGCTGATGAAGAAGGTGCACCTGAGGCCG
GATGAGGACCTGAGGAACTGTGAGAGTGACACTGAGGAGGACATCGCCAGGAGGAAAGCC
CTCCACCCACGGAGGAGGAGCAGCACCTCCTAA
Protein Properties
Number of Residues 370
Molecular Weight 42897.7
Theoretical pI 6.92
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Death-associated protein kinase 2
MFQASMRSPNMEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSR
ASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKES
LSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIED
GVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANIT
AVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITPVDNQQAMVRRESV
VNLENFRKQYVRRRWKLSFSIVSLCNHLTRSLMKKVHLRPDEDLRNCESDTEEDIARRKA
LHPRRRSSTS
GenBank ID Protein 6521210
UniProtKB/Swiss-Prot ID Q9UIK4
UniProtKB/Swiss-Prot Entry Name DAPK2_HUMAN
PDB IDs Not Available
GenBank Gene ID AB018001
GeneCard ID DAPK2
GenAtlas ID DAPK2
HGNC ID HGNC:2675
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  4. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  5. Kawai T, Nomura F, Hoshino K, Copeland NG, Gilbert DJ, Jenkins NA, Akira S: Death-associated protein kinase 2 is a new calcium/calmodulin-dependent protein kinase that signals apoptosis through its catalytic activity. Oncogene. 1999 Jun 10;18(23):3471-80. [PubMed:10376525 ]
  6. Inbal B, Shani G, Cohen O, Kissil JL, Kimchi A: Death-associated protein kinase-related protein 1, a novel serine/threonine kinase involved in apoptosis. Mol Cell Biol. 2000 Feb;20(3):1044-54. [PubMed:10629061 ]
  7. Shani G, Henis-Korenblit S, Jona G, Gileadi O, Eisenstein M, Ziv T, Admon A, Kimchi A: Autophosphorylation restrains the apoptotic activity of DRP-1 kinase by controlling dimerization and calmodulin binding. EMBO J. 2001 Mar 1;20(5):1099-113. [PubMed:11230133 ]