You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01152
Secondary Accession Numbers
  • 6448
Name Plasma membrane calcium-transporting ATPase 3
Synonyms
  1. PMCA3
  2. Plasma membrane calcium ATPase isoform 3
  3. Plasma membrane calcium pump isoform 3
Gene Name ATP2B3
Protein Type Unknown
Biological Properties
General Function Involved in ATP binding
Specific Function This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell.
Pathways
  • Calcium signaling pathway
  • Pancreatic secretion
  • Salivary secretion
Reactions Not Available
GO Classification
Biological Process
ATP biosynthetic process
blood coagulation
Cellular Component
plasma membrane
integral to membrane
Component
membrane
cell part
Function
di-, tri-valent inorganic cation transmembrane transporter activity
calcium ion transmembrane transporter activity
calcium-transporting atpase activity
binding
catalytic activity
hydrolase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
transporter activity
atpase activity, coupled to transmembrane movement of ions
atpase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
hydrolase activity, acting on acid anhydrides
Molecular Function
metal ion binding
ATP binding
calcium-transporting ATPase activity
Process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
establishment of localization
transport
ion transport
atp biosynthetic process
cation transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location X
Locus Xq28
SNPs ATP2B3
Gene Sequence
>3663 bp
ATGGGCGACATGGCCAATAGTTCCATCGAGTTCCACCCCAAGCCCCAGCAGCAGCGGGAT
GTCCCCCAGGCTGGAGGCTTTGGGTGCACGCTGGCGGAGCTGCGCACCCTCATGGAGCTG
CGAGGGGCCGAGGCGCTGCAGAAGATCGAGGAGGCCTACGGGGATGTCAGCGGGCTCTGC
CGGAGGCTGAAGACCTCACCCACAGAGGGCCTGGCGGACAACACCAATGACCTGGAGAAG
CGCAGGCAGATCTACGGGCAGAACTTCATCCCCCCAAAGCAACCCAAGACCTTCCTGCAG
CTGGTGTGGGAGGCCCTGCAGGACGTGACCCTCATCATCCTGGAGGTGGCTGCCATCGTC
TCTCTGGGCCTCTCGTTCTATGCGCCGCCAGGAGAGGAGAGTGAAGCCTGTGGGAATGTG
TCGGGAGGCGCAGAAGATGAGGGCGAGGCCGAAGCTGGCTGGATCGAGGGGGCTGCCATC
CTGCTGTCCGTCATCTGTGTGGTGCTGGTCACGGCCTTCAATGACTGGAGCAAGGAGAAG
CAGTTCCGAGGCCTGCAGAGCCGAATTGAGCAGGAGCAGAAGTTCACGGTCATCCGGAAC
GGGCAGCTCCTCCAGGTCCCCGTGGCTGCGCTGGTGGTGGGGGACATTGCCCAGGTCAAG
TACGGCGACCTGCTGCCAGCCGACGGCGTGCTCATCCAGGCCAATGACCTCAAGATCGAC
GAGAGCTCCCTGACGGGCGAGTCTGACCACGTGCGCAAGTCAGCTGACAAAGATCCCATG
CTGCTCTCAGGCACTCATGTCATGGAAGGTTCTGGAAGAATGGTGGTGACCGCCGTTGGC
GTGAATTCCCAGACAGGCATCATCTTCACGCTGCTTGGAGCTGGCGGAGAGGAGGAAGAG
AAGAAAGATAAGAAAGGCAAGCAGCAGGATGGGGCCATGGAGAGTAGCCAGACCAAAGCT
AAGAAGCAGGATGGTGCAGTGGCCATGGAGATGCAGCCCCTGAAGAGCGCGGAGGGTGGG
GAGATGGAGGAGCGGGAGAAGAAGAAAGCCAACGCACCCAAAAAGGAGAAGTCTGTCCTT
CAGGGGAAGCTCACAAAGCTAGCCGTGCAGATCGGGAAAGCAGGGCTGGTGATGTCTGCC
ATCACCGTCATCATCCTGGTCCTCTACTTTGTGATTGAGACGTTTGTCGTGGAAGGCCGG
ACATGGCTGGCAGAGTGCACGCCGGTCTATGTACAATACTTCGTGAAGTTCTTCATCATT
GGTGTCACTGTGCTGGTCGTGGCTGTCCCAGAGGGCCTGCCTCTTGCTGTCACCATCTCC
TTAGCTTACTCTGTCAAGAAAATGATGAAAGACAACAACCTGGTGCGCCACCTGGATGCC
TGCGAGACCATGGGCAACGCCACAGCCATCTGCTCCGACAAGACGGGCACGCTCACCACC
AACCGTATGACCGTGGTCCAGTCCTACCTAGGAGACACCCACTACAAAGAGATTCCGGCC
CCCAGCGCCCTGACCCCTAAGATCCTCGACCTCCTGGTCCATGCCATCTCCATCAACAGT
GCCTATACCACCAAAATACTACCTCCTGAGAAGGAAGGCGCCCTCCCACGCCAGGTGGGC
AATAAGACGGAGTGCGCCCTGCTGGGCTTCGTCTTGGACCTGAAGCGGGACTTCCAGCCC
GTGCGCGAGCAGATCCCGGAAGACAAGCTTTACAAAGTGTACACCTTCAACTCGGTCCGC
AAGTCCATGAGCACAGTCATCCGCATGCCCGACGGTGGCTTCCGCCTCTTCAGCAAGGGG
GCCTCAGAGATCCTCTTGAAAAAGTGCACCAACATCTTGAACAGCAATGGCGAACTCCGG
GGCTTTCGGCCTCGGGACCGGGACGACATGGTGAGGAAGATCATCGAGCCGATGGCTTGC
GATGGCCTCCGCACCATCTGCATCGCCTACCGGGACTTCTCTGCAGGCCAGGAGCCCGAC
TGGGACAACGAGAATGAGGTCGTGGGTGACCTCACCTGCATAGCTGTCGTGGGCATTGAG
GACCCTGTGCGGCCCGAGGTCCCTGAAGCTATCCGAAAATGCCAGCGTGCTGGCATCACA
GTCCGCATGGTGACTGGGGACAACATCAACACGGCCCGGGCCATCGCAGCCAAATGCGGC
ATCATCCAGCCCGGGGAGGACTTCCTGTGCCTAGAAGGGAAGGAGTTCAACCGGCGGATC
CGCAATGAGAAAGGCGAGATAGAACAGGAGCGGCTGGACAAGGTGTGGCCCAAGCTGAGG
GTGCTGGCCCGGTCGTCTCCCACCGACAAGCACACACTGGTCAAAGGGATTATCGACAGC
ACCACTGGTGAGCAGCGGCAGGTGGTGGCTGTGACAGGGGATGGCACCAACGATGGGCCG
GCCCTCAAGAAGGCGGACGTGGGCTTCGCCATGGGCATCGCAGGGACCGACGTGGCCAAG
GAGGCCTCCGACATCATCCTGACCGATGACAACTTCACCAGCATCGTCAAGGCAGTCATG
TGGGGCCGTAACGTCTATGACAGCATCTCCAAGTTCCTGCAGTTTCAACTGACGGTCAAT
GTGGTGGCTGTGATCGTGGCCTTCACAGGTGCCTGCATTACTCAGGACTCTCCTCTCAAA
GCCGTGCAGATGTTGTGGGTGAACTTGATCATGGACACATTTGCCTCTCTGGCCCTGGCG
ACGGAGCCACCCACAGAGTCGCTGCTGCTGCGGAAGCCGTACGGCCGCGACAAGCCCCTC
ATCTCCCGCACCATGATGAAGAACATTCTGGGCCACGCCGTGTACCAGCTCGCCATCATC
TTCACCCTGCTGTTTGTCGGGGAGCTCTTCTTCGACATCGACAGCGGGAGGAATGCGCCC
CTGCACTCGCCACCCTCAGAGCACTACACCATCATCTTCAACACGTTCGTCATGATGCAG
CTCTTTAACGAGATCAACGCCCGCAAGATCCACGGCGAGAGGAACGTGTTCGACGGCATC
TTCAGCAACCCCATCTTCTGCACCATCGTTTTGGGCACTTTCGGGATTCAGATTGTCATC
GTCCAGTTTGGCGGGAAGCCCTTCAGCTGCTCCCCACTATCCACAGAACAGTGGCTCTGG
TGCCTGTTTGTTGGTGTTGGGGAGCTGGTCTGGGGACAGGTCATTGCCACCATCCCCACC
AGCCAGCTCAAGTGCCTGAAGGAAGCCGGGCACGGGCCCGGGAAGGACGAGATGACCGAC
GAGGAGCTGGCCGAAGGCGAGGAAGAGATCGACCATGCCGAGCGGGAGCTCCGCAGGGGC
CAGATCCTCTGGTTCCGGGGCCTGAACCGGATTCAGACGCAGATCCGGGTGGTGAAAGCG
TTCCGTAGCTCGCTCTATGAAGGCCTGGAGAAACCAGAATCCAAGACCTCCATTCACAAC
TTCATGGCCACGCCCGAGTTTCTGATCAATGACTACACCCACAACATCCCGCTCATTGAC
GACACGGACGTGGACGAGAACGAGGAGCGCCTCCGGGCCCCCCCGCCCCCGTCCCCCAAC
CAGAACAACAACGCCATAGACAGCGGCATCTACCTGACCACGCATGTCACCAAGTCAGCT
ACCTCTTCAGTGTTTTCCTCCAGTCCCGGGAGCCCGCTCCACAGCGTGGAGACGTCCCTC
TAA
Protein Properties
Number of Residues 1220
Molecular Weight 134196.025
Theoretical pI 5.614
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Plasma membrane calcium-transporting ATPase 3
MGDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEEAYGDVSGLC
RRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIV
SLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEK
QFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKID
ESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEE
KKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANAPKKEKSVL
QGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFII
GVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTT
NRMTVVQSYLGDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVG
NKTECALLGFVLDLKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKG
ASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDFSAGQEPD
WDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCG
IIQPGEDFLCLEGKEFNRRIRNEKGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDS
TTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVM
WGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALA
TEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAP
LHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVI
VQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQLKCLKEAGHGPGKDEMTD
EELAEGEEEIDHAERELRRGQILWFRGLNRIQTQIRVVKAFRSSLYEGLEKPESKTSIHN
FMATPEFLINDYTHNIPLIDDTDVDENEERLRAPPPPSPNQNNNAIDSGIYLTTHVTKSA
TSSVFSSSPGSPLHSVETSL
GenBank ID Protein 48255955
UniProtKB/Swiss-Prot ID Q16720
UniProtKB/Swiss-Prot Entry Name AT2B3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001001344.2
GeneCard ID ATP2B3
GenAtlas ID ATP2B3
HGNC ID HGNC:816
References
General References
  1. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  2. Mallon AM, Platzer M, Bate R, Gloeckner G, Botcherby MR, Nordsiek G, Strivens MA, Kioschis P, Dangel A, Cunningham D, Straw RN, Weston P, Gilbert M, Fernando S, Goodall K, Hunter G, Greystrong JS, Clarke D, Kimberley C, Goerdes M, Blechschmidt K, Rump A, Hinzmann B, Mundy CR, Miller W, Poustka A, Herman GE, Rhodes M, Denny P, Rosenthal A, Brown SD: Comparative genome sequence analysis of the Bpa/Str region in mouse and Man. Genome Res. 2000 Jun;10(6):758-75. [PubMed:10854409 ]
  3. Brown BJ, Hilfiker H, DeMarco SJ, Zacharias DA, Greenwood TM, Guerini D, Strehler EE: Primary structure of human plasma membrane Ca(2+)-ATPase isoform 3. Biochim Biophys Acta. 1996 Aug 14;1283(1):10-3. [PubMed:8765088 ]
  4. Wang MG, Yi H, Hilfiker H, Carafoli E, Strehler EE, McBride OW: Localization of two genes encoding plasma membrane Ca2+ ATPases isoforms 2 (ATP2B2) and 3 (ATP2B3) to human chromosomes 3p26-->p25 and Xq28, respectively. Cytogenet Cell Genet. 1994;67(1):41-5. [PubMed:8187550 ]
  5. Stauffer TP, Hilfiker H, Carafoli E, Strehler EE: Quantitative analysis of alternative splicing options of human plasma membrane calcium pump genes. J Biol Chem. 1993 Dec 5;268(34):25993-6003. [PubMed:8245032 ]
  6. Stauffer TP, Hilfiker H, Carafoli E, Strehler EE: Quantitative analysis of alternative splicing options of human plasma membrane calcium pump genes. J Biol Chem. 1994 Dec 16;269(50):32022. [PubMed:7989379 ]