Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01157
Secondary Accession Numbers
  • 6453
Name Macrophage-stimulating protein receptor
Synonyms
  1. CD136 antigen
  2. CDw136
  3. MSP receptor
  4. Macrophage-stimulating protein receptor alpha chain
  5. Macrophage-stimulating protein receptor beta chain
  6. Protein-tyrosine kinase 8
  7. p185-Ron
Gene Name MST1R
Protein Type Enzyme
Biological Properties
General Function Involved in receptor activity
Specific Function Receptor for macrophage stimulating protein (MSP). Has a tyrosine-protein kinase activity
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
protein tyrosine kinase activity
transmembrane receptor protein tyrosine kinase activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
receptor activity
protein binding
molecular transducer activity
signal transducer activity
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
enzyme linked receptor protein signaling pathway
transmembrane receptor protein tyrosine kinase signaling pathway
metabolic process
multicellular organismal process
multicellular organismal development
cellular metabolic process
protein amino acid phosphorylation
signaling
signaling pathway
cell surface receptor linked signaling pathway
phosphorylation
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:3
Locus 3p21.3
SNPs MST1R
Gene Sequence
>4203 bp
ATGGAGCTCCTCCCGCCGCTGCCTCAGTCCTTCCTGTTGCTGCTGCTGTTGCCTGCCAAG
CCCGCGGCGGGCGAGGACTGGCAGTGCCCGCGCACCCCCTACGCGGCCTCTCGCGACTTT
GACGTGAAGTACGTGGTGCCCAGCTTCTCCGCCGGAGGCCTGGTACAGGCCATGGTGACC
TACGAGGGCGACAGAAATGAGAGTGCTGTGTTTGTAGCCATACGCAATCGCCTGCATGTG
CTTGGGCCTGACCTGAAGTCTGTCCAGAGCCTGGCCACGGGCCCTGCTGGAGACCCTGGC
TGCCAGACGTGTGCAGCCTGTGGCCCAGGACCCCACGGCCCTCCCGGTGACACAGACACA
AAGGTGCTGGTGCTGGATCCCGCGCTGCCTGCGCTGGTCAGTTGTGGCTCCAGCCTGCAG
GGCCGCTGCTTCCTGCATGACCTAGAGCCCCAAGGGACAGCCGTGCATCTGGCAGCGCCA
GCCTGCCTCTTCTCAGCCCACCATAACCGGCCCGATGACTGCCCCGACTGTGTGGCCAGC
CCATTGGGCACCCGTGTAACTGTGGTTGAGCAAGGCCAGGCCTCCTATTTCTACGTGGCA
TCCTCACTGGACGCAGCCGTGGCTGCCAGCTTCAGCCCACGCTCAGTGTCTATCAGGCGT
CTCAAGGCTGACGCCTCGGGATTCGCACCGGGCTTTGTGGCGTTGTCAGTGCTGCCCAAG
CATCTTGTCTCCTACAGTATTGAATACGTGCACAGCTTCCACACGGGAGCCTTCGTATAC
TTCCTGACTGTACAGCCGGCCAGCGTGACAGATGATCCTAGTGCCCTGCACACACGCCTG
GCACGGCTTAGCGCCACTGAGCCAGAGTTGGGTGACTATCGGGAGCTGGTCCTCGACTGC
AGATTTGCTCCAAAACGCAGGCGCCGGGGGGCCCCAGAAGGCGGACAGCCCTACCCTGTG
CTGCGGGTGGCCCACTCCGCTCCAGTGGGTGCCCAACTTGCCACTGAGCTGAGCATCGCC
GAGGGCCAGGAAGTACTATTTGGGGTCTTTGTGACTGGCAAGGATGGTGGTCCTGGCGTG
GGCCCCAACTCTGTCGTCTGTGCCTTCCCCATTGACCTGCTGGACACACTAATTGATGAG
GGTGTGGAGCGCTGTTGTGAATCCCCAGTCCATCCAGGCCTCCGGCGAGGCCTCGACTTC
TTCCAGTCGCCCAGTTTTTGCCCCAACCCGCCTGGCCTGGAAGCCCTCAGCCCCAACACC
AGCTGCCGCCACTTCCCTCTGCTGGTCAGTAGCAGCTTCTCACGTGTGGACCTATTCAAT
GGGCTGTTGGGACCAGTACAGGTCACTGCATTGTATGTGACACGCCTTGACAACGTCACA
GTGGCACACATGGGCACAATGGATGGGCGTATCCTGCAGGTGGAGCTGGTCAGGTCACTA
AACTACTTGCTGTATGTGTCCAACTTCTCACTGGGTGACAGTGGGCAGCCCGTGCAGCGG
GATGTCAGTCGTCTTGGGGACCACCTACTCTTTGCCTCTGGGGACCAGGTTTTCCAGGTA
CCTATCCAAGGCCCTGGCTGCCGCCACTTCCTGACCTGTGGGCGTTGCCTAAGGGCATGG
CATTTCATGGGCTGTGGCTGGTGTGGGAACATGTGCGGCCAGCAGAAGGAGTGTCCTGGC
TCCTGGCAACAGGACCACTGCCCACCTAAGCTTACTGAGTTCCACCCCCACAGTGGACCT
CTAAGGGGCAGTACAAGGCTGACCCTGTGTGGCTCCAACTTCTACCTTCACCCTTCTGGT
CTGGTGCCTGAGGGAACCCATCAGGTCACTGTGGGCCAAAGTCCCTGCCGGCCACTGCCC
AAGGACAGCTCAAAACTCAGACCAGTGCCCCGGAAAGACTTTGTAGAGGAGTTTGAGTGT
GAACTGGAGCCCTTGGGCACCCAGGCAGTGGGGCCTACCAACGTCAGCCTCACCGTGACT
AACATGCCACCGGGCAAGCACTTCCGGGTAGACGGCACCTCCGTGCTGAGAGGCTTCTCT
TTCATGGAGCCAGTGCTGATAGCAGTGCAACCCCTCTTTGGCCCACGGGCAGGAGGCACC
TGTCTCACTCTTGAAGGCCAGAGTCTGTCTGTAGGCACCAGCCGGGCTGTGCTGGTCAAT
GGGACTGAGTGTCTGCTAGCACGGGTCAGTGAGGGGCAGCTTTTATGTGCCACACCCCCT
GGGGCCACGGTGGCCAGTGTCCCCCTTAGCCTGCAGGTGGGGGGTGCCCAGGTACCTGGT
TCCTGGACCTTCCAGTACAGAGAAGACCCTGTCGTGCTAAGCATCAGCCCCAACTGTGGC
TACATCAACTCCCACATCACCATCTGTGGCCAGCATCTAACTTCAGCATGGCACTTAGTG
CTGTCATTCCATGACGGGCTTAGGGCAGTGGAAAGCAGGTGTGAGAGGCAGCTTCCAGAG
CAGCAGCTGTGCCGCCTTCCTGAATATGTGGTCCGAGACCCCCAGGGATGGGTGGCAGGG
AATCTGAGTGCCCGAGGGGATGGAGCTGCTGGCTTTACACTGCCTGGCTTTCGCTTCCTA
CCCCCACCCCATCCACCCAGTGCCAACCTAGTTCCACTGAAGCCTGAGGAGCATGCCATT
AAGTTTGAGTATATTGGGCTGGGCGCTGTGGCTGACTGTGTGGGTATCAACGTGACCGTG
GGTGGTGAGAGCTGCCAGCACGAGTTCCGGGGGGACATGGTTGTCTGCCCCCTGCCCCCA
TCCCTGCAGCTTGGCCAGGATGGTGCCCCATTGCAGGTCTGCGTAGATGGTGAATGTCAT
ATCCTGGGTAGAGTGGTGCGGCCAGGGCCAGATGGGGTCCCACAGAGCACGCTCCTTGGT
ATCCTGCTGCCTTTGCTGCTGCTTGTGGCTGCACTGGCGACTGCACTGGTCTTCAGCTAC
TGGTGGCGGAGGAAGCAGCTAGTTCTTCCTCCCAACCTGAATGACCTGGCATCCCTGGAC
CAGACTGCTGGAGCCACACCCCTGCCTATTCTGTACTCGGGCTCTGACTACAGAAGTGGC
CTTGCACTCCCTGCCATTGATGGTCTGGATTCCACCACTTGTGTCCATGGAGCATCCTTC
TCCGATAGTGAAGATGAATCCTGTGTGCCACTGCTGCGGAAAGAGTCCATCCAGCTAAGG
GACCTGGACTCTGCGCTCTTGGCTGAGGTCAAGGATGTGCTGATTCCCCATGAGCGGGTG
GTCACCCACAGTGACCGAGTCATTGGCAAAGGCCACTTTGGAGTTGTCTACCACGGAGAA
TACATAGACCAGGCCCAGAATCGAATCCAATGTGCCATCAAGTCACTAAGTCGCATCACA
GAGATGCAGCAGGTGGAGGCCTTCCTGCGAGAGGGGCTGCTCATGCGTGGCCTGAACCAC
CCGAATGTGCTGGCTCTCATTGGTATCATGTTGCCACCTGAGGGCCTGCCCCATGTGCTG
CTGCCCTATATGTGCCACGGTGACCTGCTCCAGTTCATCCGCTCACCTCAGCGGAACCCC
ACCGTGAAGGACCTCATCAGCTTTGGCCTGCAGGTAGCCCGCGGCATGGAGTACCTGGCA
GAGCAGAAGTTTGTGCACAGGGACCTGGCTGCGCGGAACTGCATGCTGGACGAGTCATTC
ACAGTCAAGGTGGCTGACTTTGGTTTGGCCCGCGACATCCTGGACAGGGAGTACTATAGT
GTTCAACAGCATCGCCACGCTCGCCTACCTGTGAAGTGGATGGCGCTGGAGAGCCTGCAG
ACCTATAGATTTACCACCAAGTCTGATGTGTGGTCATTTGGTGTGCTGCTGTGGGAACTG
CTGACACGGGGTGCCCCACCATACCGCCACATTGACCCTTTTGACCTTACCCACTTCCTG
GCCCAGGGTCGGCGCCTGCCCCAGCCTGAGTATTGCCCTGATTCTCTGTACCAAGTGATG
CAGCAATGCTGGGAGGCAGACCCAGCAGTGCGACCCACCTTCAGAGTACTAGTGGGGGAG
GTGGAGCAGATAGTGTCTGCACTGCTTGGGGACCATTATGTGCAGCTGCCAGCAACCTAC
ATGAACTTGGGCCCCAGCACCTCGCATGAGATGAATGTGCGTCCAGAACAGCCGCAGTTC
TCACCCATGCCAGGGAATGTACGCCGGCCCCGGCCACTCTCAGAGCCTCCTCGGCCCACT
TGA
Protein Properties
Number of Residues 1400
Molecular Weight 152270.1
Theoretical pI 6.53
Pfam Domain Function
Signals
  • 1-24
Transmembrane Regions
  • 958-978
Protein Sequence
>Macrophage-stimulating protein receptor
MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVT
YEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDT
KVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVAS
PLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPK
HLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDC
RFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGV
GPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNT
SCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSL
NYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAW
HFMGCGWCGNMCGQQKECPGSWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSG
LVPEGTHQVTVGQSPCRPLPKDSSKLRPVPRKDFVEEFECELEPLGTQAVGPTNVSLTVT
NMPPGKHFRVDGTSVLRGFSFMEPVLIAVQPLFGPRAGGTCLTLEGQSLSVGTSRAVLVN
GTECLLARVSEGQLLCATPPGATVASVPLSLQVGGAQVPGSWTFQYREDPVVLSISPNCG
YINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAG
NLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEYIGLGAVADCVGINVTV
GGESCQHEFRGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGPDGVPQSTLLG
ILLPLLLLVAALATALVFSYWWRRKQLVLPPNLNDLASLDQTAGATPLPILYSGSDYRSG
LALPAIDGLDSTTCVHGASFSDSEDESCVPLLRKESIQLRDLDSALLAEVKDVLIPHERV
VTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRITEMQQVEAFLREGLLMRGLNH
PNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFGLQVARSMEYLA
EQKFVHRDLAARNCMLDESFTVKVADFGLARDILDREYYSVQQHRHARLPVKWMALESLQ
TYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQPEYCPDSLYQVM
QQCWEADPAVRPTFRVLVGEVEQIVSALLGDHYVQLPATYMNLGPSTSHEMNVRPEQPQF
SPMPGNVRRPRPLSEPPRPT
GenBank ID Protein 153946393
UniProtKB/Swiss-Prot ID Q04912
UniProtKB/Swiss-Prot Entry Name RON_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_002447.2
GeneCard ID MST1R
GenAtlas ID MST1R
HGNC ID HGNC:7381
References
General References
  1. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]
  2. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  3. Jin P, Zhang J, Sumariwalla PF, Ni I, Jorgensen B, Crawford D, Phillips S, Feldmann M, Shepard HM, Paleolog EM: Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis. Arthritis Res Ther. 2008;10(4):R73. doi: 10.1186/ar2447. Epub 2008 Jul 1. [PubMed:18593464 ]
  4. Ronsin C, Muscatelli F, Mattei MG, Breathnach R: A novel putative receptor protein tyrosine kinase of the met family. Oncogene. 1993 May;8(5):1195-202. [PubMed:8386824 ]
  5. Collesi C, Santoro MM, Gaudino G, Comoglio PM: A splicing variant of the RON transcript induces constitutive tyrosine kinase activity and an invasive phenotype. Mol Cell Biol. 1996 Oct;16(10):5518-26. [PubMed:8816464 ]
  6. Wang MH, Ronsin C, Gesnel MC, Coupey L, Skeel A, Leonard EJ, Breathnach R: Identification of the ron gene product as the receptor for the human macrophage stimulating protein. Science. 1994 Oct 7;266(5182):117-9. [PubMed:7939629 ]
  7. Danilkovitch-Miagkova A, Duh FM, Kuzmin I, Angeloni D, Liu SL, Miller AD, Lerman MI: Hyaluronidase 2 negatively regulates RON receptor tyrosine kinase and mediates transformation of epithelial cells by jaagsiekte sheep retrovirus. Proc Natl Acad Sci U S A. 2003 Apr 15;100(8):4580-5. Epub 2003 Apr 3. [PubMed:12676986 ]
  8. Conrotto P, Corso S, Gamberini S, Comoglio PM, Giordano S: Interplay between scatter factor receptors and B plexins controls invasive growth. Oncogene. 2004 Jul 1;23(30):5131-7. [PubMed:15184888 ]