You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01163
Secondary Accession Numbers
  • 6459
Name Glucosidase 2 subunit beta
Synonyms
  1. 80K-H protein
  2. Glucosidase II subunit beta
  3. PKCSH
  4. Protein kinase C substrate 60.1 kDa protein heavy chain
Gene Name PRKCSH
Protein Type Enzyme
Biological Properties
General Function Involved in calcium ion binding
Specific Function Regulatory subunit of glucosidase II
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
Cellular Location
  1. Endoplasmic reticulum (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.2
SNPs PRKCSH
Gene Sequence
>1587 bp
ATGCTGTTGCCGCTGCTGCTGCTGCTACCCATGTGCTGGGCCGTGGAGGTCAAGAGGCCC
CGGGGCGTCTCCCTCACCAATCATCACTTCTACGATGAGTCCAAGCCTTTCACCTGCCTG
GACGGTTCGGCCACCATCCCATTTGATCAGGTCAACGATGACTATTGCGACTGCAAAGAT
GGCTCTGACGAGCCAGGCACGGCTGCCTGTCCTAATGGCAGCTTCCACTGCACCAACACT
GGCTATAAGCCCCTGTATATCCCCTCCAACCGGGTCAACGATGGTGTTTGTGACTGCTGC
GATGGAACAGACGAGTACAACAGCGGCGTCATCTGTGAGAACACCTGCAAAGAGAAGGGC
CGTAAGGAGAGAGAGTCCCTGCAGCAGATGGCCGAGGTCACCCGCGAAGGGTTCCGTCTG
AAGAAGATCCTTATTGAGGACTGGAAGAAGGCACGGGAGGAGAAGCAGAAAAAGCTCATT
GAGCTACAGGCTGGGAAGAAGTCTCTGGAAGACCAGGTGGAGATGCTGCGGACAGTGAAG
GAGGAAGCTGAGAAGCCAGAGAGAGAGGCCAAAGAGCAGCACCAGAAGCTGTGGGAAGAG
CAGCTGGCTGCTGCCAAGGCCCAACAGGAGCAGGAGCTGGCGGCTGATGCCTTCAAGGAG
CTGGATGATGACATGGACGGGACAGTCTCGGTGACTGAGCTGCAGACTCACCCGGAGCTG
GACACAGATGGGGATGGGGCGTTGTCAGAAGCGGAAGCTCAGGCCCTCCTCAGTGGGGAC
ACACAGACAGACGCCACCTCTTTCTACGACCGCGTCTGGGCCGCCATCAGGGACAAGTAC
CGGTCCGAGGCACTGCCCACCGACCTTCCAGCACCTTCTGCCCCTGACTTGACGGAGCCC
AAGGAGGAGCAGCCGCCAGTGCCCTCGTCGCCCACAGAGGAGGAGGAGGAGGAGGAGGAG
GAGGAGGAAGAAGAGGCTGAAGAAGAGGAGGAGGAGGAGGATTCCGAGGAGGCCCCACCG
CCACTGTCACCCCCGCAGCCGGCCAGCCCTGCTGAGGAAGACAAAATGCCGCCCTACGAC
GAGCAGACGCAGGCCTTCATCGATGCTGCCCAGGAGGCCCGCAACAAGTTCGAGGAGGCC
GAGCGGTCGCTGAAGGACATGGAGGAGTCCATCAGGAACCTGGAGCAAGAGATTTCTTTT
GACTTTGGCCCCAACGGGGAGTTTGCTTACCTGTACAGCCAGTGCTACGAGCTCACCACC
AACGAATACGTCTACCGCCTCTGCCCCTTCAAGCTTGTCTCGCAGAAACCCAAACTCGGG
GGCTCTCCCACCAGCCTTGGCACCTGGGGCTCATGGATCGGCCCCGACCACGACAAGTTC
AGTGCCATGAAGTATGAGCAAGGCACGGGCTGCTGGCAGGGCCCCAACCGCTCCACCACC
GTGCGCCTCCTGTGCGGGAAAGAGACCATGGTGACCAGCACCACAGAGCCCAGTCGCTGC
GAGTACCTCATGGAGCTGATGACGCCAGCCGCCTGCCCGGAGCCACCGCCTGAAGCACCC
ACCGAAGACGACCATGACGAGCTCTAG
Protein Properties
Number of Residues 528
Molecular Weight 59424.9
Theoretical pI 4.05
Pfam Domain Function
Signals
  • 1-14
Transmembrane Regions
  • None
Protein Sequence
>Glucosidase 2 subunit beta
MLLPLLLLLPMCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKD
GSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGVICENTCKEKG
RKERESLQQMAEVTREGFRLKKILIEDWKKAREEKQKKLIELQAGKKSLEDQVEMLRTVK
EEAEKPEREAKEQHQKLWEEQLAAAKAQQEQELAADAFKELDDDMDGTVSVTELQTHPEL
DTDGDGALSEAEAQALLSGDTQTDATSFYDRVWAAIRDKYRSEALPTDLPAPSAPDLTEP
KEEQPPVPSSPTEEEEEEEEEEEEEAEEEEEEEDSEEAPPPLSPPQPASPAEEDKMPPYD
EQTQAFIDAAQEARNKFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAYLYSQCYELTT
NEYVYRLCPFKLVSQKPKLGGSPTSLGTWGSWIGPDHDKFSAMKYEQGTGCWQGPNRSTT
VRLLCGKETMVTSTTEPSRCEYLMELMTPAACPEPPPEAPTEDDHDEL
GenBank ID Protein 7672979
UniProtKB/Swiss-Prot ID P14314
UniProtKB/Swiss-Prot Entry Name GLU2B_HUMAN
PDB IDs Not Available
GenBank Gene ID AF144075
GeneCard ID PRKCSH
GenAtlas ID PRKCSH
HGNC ID HGNC:9411
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. [PubMed:12665801 ]
  3. Pelletier MF, Marcil A, Sevigny G, Jakob CA, Tessier DC, Chevet E, Menard R, Bergeron JJ, Thomas DY: The heterodimeric structure of glucosidase II is required for its activity, solubility, and localization in vivo. Glycobiology. 2000 Aug;10(8):815-27. [PubMed:10929008 ]
  4. Sakai K, Hirai M, Minoshima S, Kudoh J, Fukuyama R, Shimizu N: Isolation of cDNAs encoding a substrate for protein kinase C: nucleotide sequence and chromosomal mapping of the gene for a human 80K protein. Genomics. 1989 Aug;5(2):309-15. [PubMed:2793184 ]
  5. Ophoff RA, Terwindt GM, Vergouwe MN, van Eijk R, Mohrenweiser H, Litt M, Hofker MH, Haan J, Ferrari MD, Frants RR: A 3-Mb region for the familial hemiplegic migraine locus on 19p13.1-p13.2: exclusion of PRKCSH as a candidate gene. Dutch Migraine Genetic Research Group. Eur J Hum Genet. 1996;4(6):321-8. [PubMed:9043864 ]
  6. Li A, Davila S, Furu L, Qian Q, Tian X, Kamath PS, King BF, Torres VE, Somlo S: Mutations in PRKCSH cause isolated autosomal dominant polycystic liver disease. Am J Hum Genet. 2003 Mar;72(3):691-703. Epub 2003 Jan 15. [PubMed:12529853 ]
  7. Drenth JP, te Morsche RH, Smink R, Bonifacino JS, Jansen JB: Germline mutations in PRKCSH are associated with autosomal dominant polycystic liver disease. Nat Genet. 2003 Mar;33(3):345-7. Epub 2003 Feb 10. [PubMed:12577059 ]