Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01164
Secondary Accession Numbers
  • 6460
Name Katanin p60 ATPase-containing subunit A1
Synonyms
  1. Katanin p60 subunit A1
  2. p60 katanin
Gene Name KATNA1
Protein Type Enzyme
Biological Properties
General Function Involved in nucleotide binding
Specific Function Catalytic subunit of a complex which severs microtubules in an ATP-dependent manner. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. Microtubule release from the mitotic spindle poles may allow depolymerization of the microtubule end proximal to the spindle pole, leading to poleward microtubule flux and poleward motion of chromosome. Microtubule release within the cell body of neurons may be required for their transport into neuronal processes by microtubule-dependent motor proteins. This transport is required for axonal growth (By similarity).
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
cell division
cytoplasmic microtubule organization
interphase of mitotic cell cycle
microtubule bundle formation
microtubule severing
neuron migration
protein localization
negative regulation of neuron projection development
mitosis
Cellular Component
centrosome
growth cone
plasma membrane
nucleus
lipid particle
neuronal cell body
spindle pole
axon
microtubule
Function
binding
nucleotide binding
catalytic activity
hydrolase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Molecular Function
ATP binding
microtubule binding
microtubule-severing ATPase activity
Cellular Location
  1. Cytoplasm
  2. Cytoplasm
  3. Cytoplasm
  4. cytoskeleton
  5. cytoskeleton
  6. centrosome
  7. spindle pole
Gene Properties
Chromosome Location 6
Locus 6q25.1
SNPs KATNA1
Gene Sequence
>1476 bp
ATGAGTCTTCTTATGATTAGTGAGAATGTAAAATTGGCTCGTGAATATGCATTGCTGGGA
AACTATGACTCTGCGATGGTCTATTATCAGGGAGTTCTTGACCAAATGAACAAGTATCTG
TACTCAGTCAAAGATACATACCTCCAGCAGAAATGGCAACAGGTTTGGCAGGAAATAAAT
GTGGAAGCTAAACATGTTAAAGATATCATGAAAACACTAGAGAGCTTTAAACTGGACAGC
ACTCCCTTGAAAGCGGCACAGCATGACCTTCCAGCTTCTGAGGGAGAAGTCTGGTCCATG
CCTGTACCTGTTGAACGAAGACCCTCACCAGGACCTAGAAAACGCCAATCTTCTCAGTAC
AGTGACCCTAAATCACATGGTAATCGTCCAAGTACAACTGTCAGAGTTCACCGTTCATCT
GCACAGAATGTTCACAATGACAGAGGGAAAGCTGTTCGTTGTCGTGAAAAGAAAGAACAG
AATAAAGGAAGAGAGGAAAAGAACAAATCACCTGCTGCAGTAACAGAACCAGAGACAAAT
AAATTTGATAGTACCGGATATGATAAAGACTTAGTAGAAGCTTTGGAAAGAGATATAATT
TCCCAGAATCCCAATGTTCGATGGGATGATATCGCTGATTTAGTAGAAGCTAAAAAGTTG
CTTAAGGAAGCCGTAGTGTTACCAATGTGGATGCCCGAATTCTTTAAGGGCATTAGGAGA
CCATGGAAAGGAGTACTGATGGTCGGCCCACCTGGCACGGGGAAGACGCTCCTTGCTAAA
GCAGTAGCTACAGAATGCAAGACAACATTCTTCAATGTCTCTTCATCAACTTTGACTTCC
AAATACAGAGGAGAATCTGAGAAGCTTGTTCGTCTTCTGTTTGAAATGGCTCGATTTTAT
TCTCCAGCCACCATATTTATTGATGAGATAGACTCCATCTGTAGTCGCCGAGGGACTTCT
GAAGAACATGAAGCAAGCAGAAGGGTGAAAGCGGAGCTGCTGGTTCAGATGGATGGTGTT
GGAGGTACTTCTGAAAATGATGACCCTTCCAAAATGGTTATGGTTCTGGCAGCTACTAAT
TTTCCCTGGGATATAGATGAGGCTTTAAGACGACGCCTTGAGAAACGAATCTATATTCCT
TTGCCGTCAGCAAAAGGCAGGGAGGAGCTATTACGAATAAGTCTACGTGAGTTGGAATTG
GCTGATGATGTTGACCTTGCAAGTATAGCAGAAAACATGGAAGGTTATTCAGGTGCGGAC
ATTACCAACGTGTGCAGGGATGCGTCCTTGATGGCAATGAGAAGGCGCATTGAAGGTTTG
ACTCCAGAGGAAATCCGAAATCTTTCCAAAGAAGAAATGCACATGCCTACAACTATGGAG
GATTTCGAGATGGCTTTAAAAAAGGTTTCTAAGTCAGTGTCTGCTGCAGACATTGAAAGA
TACGAGAAATGGATATTTGAGTTTGGATCATGCTAA
Protein Properties
Number of Residues 491
Molecular Weight 35319.06
Theoretical pI 9.267
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Katanin p60 ATPase-containing subunit A1
MSLLMISENVKLAREYALLGNYDSAMVYYQGVLDQMNKYLYSVKDTYLQQKWQQVWQEIN
VEAKHVKDIMKTLESFKLDSTPLKAAQHDLPASEGEVWSMPVPVERRPSPGPRKRQSSQY
SDPKSHGNRPSTTVRVHRSSAQNVHNDRGKAVRCREKKEQNKGREEKNKSPAAVTEPETN
KFDSTGYDKDLVEALERDIISQNPNVRWDDIADLVEAKKLLKEAVVLPMWMPEFFKGIRR
PWKGVLMVGPPGTGKTLLAKAVATECKTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFY
SPATIFIDEIDSICSRRGTSEEHEASRRVKAELLVQMDGVGGTSENDDPSKMVMVLAATN
FPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLRELELADDVDLASIAENMEGYSGAD
ITNVCRDASLMAMRRRIEGLTPEEIRNLSKEEMHMPTTMEDFEMALKKVSKSVSAADIER
YEKWIFEFGSC
GenBank ID Protein 3283072
UniProtKB/Swiss-Prot ID O75449
UniProtKB/Swiss-Prot Entry Name KTNA1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF056022
GeneCard ID KATNA1
GenAtlas ID KATNA1
HGNC ID HGNC:6216
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  6. McNally FJ, Thomas S: Katanin is responsible for the M-phase microtubule-severing activity in Xenopus eggs. Mol Biol Cell. 1998 Jul;9(7):1847-61. [PubMed:9658175 ]
  7. McNally KP, Bazirgan OA, McNally FJ: Two domains of p80 katanin regulate microtubule severing and spindle pole targeting by p60 katanin. J Cell Sci. 2000 May;113 ( Pt 9):1623-33. [PubMed:10751153 ]
  8. Buster D, McNally K, McNally FJ: Katanin inhibition prevents the redistribution of gamma-tubulin at mitosis. J Cell Sci. 2002 Mar 1;115(Pt 5):1083-92. [PubMed:11870226 ]