Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01167
Secondary Accession Numbers
  • 6463
Name Receptor tyrosine-protein kinase erbB-3
Synonyms
  1. Proto-oncogene-like protein c-ErbB-3
  2. Tyrosine kinase-type cell surface receptor HER3
Gene Name ERBB3
Protein Type Enzyme
Biological Properties
General Function Involved in transmembrane receptor protein tyrosine kinase activity
Specific Function Binds and is activated by neuregulins and NTAK
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
protein tyrosine kinase activity
transmembrane receptor protein tyrosine kinase activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
receptor signaling protein tyrosine kinase activity
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
peptidyl-tyrosine phosphorylation
enzyme linked receptor protein signaling pathway
transmembrane receptor protein tyrosine kinase signaling pathway
metabolic process
cellular metabolic process
protein amino acid phosphorylation
signaling
signaling pathway
cell surface receptor linked signaling pathway
phosphorylation
Cellular Location
  1. Isoform 2:Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 12q13
SNPs ERBB3
Gene Sequence
>4029 bp
ATGAGGGCGAACGACGCTCTGCAGGTGCTGGGCTTGCTTTTCAGCCTGGCCCGGGGCTCC
GAGGTGGGCAACTCTCAGGCAGTGTGTCCTGGGACTCTGAATGGCCTGAGTGTGACCGGC
GATGCTGAGAACCAATACCAGACACTGTACAAGCTCTACGAGAGGTGTGAGGTGGTGATG
GGGAACCTTGAGATTGTGCTCACGGGACACAATGCCGACCTCTCCTTCCTGCAGTGGATT
CGAGAAGTGACAGGCTATGTCCTCGTGGCCATGAATGAATTCTCTACTCTACCATTGCCC
AACCTCCGCGTGGTGCGAGGGACCCAGGTCTACGATGGGAAGTTTGCCATCTTCGTCATG
TTGAACTATAACACCAACTCCAGCCACGCTCTGCGCCAGCTCCGCTTGACTCAGCTCACC
GAGATTCTGTCAGGGGGTGTTTATATTGAGAAGAACGATAAGCTTTGTCACATGGACACA
ATTGACTGGAGGGACATCGTGAGGGACCGAGATGCTGAGATAGTGGTGAAGGACAATGGC
AGAAGCTGTCCCCCCTGTCATGAGGTTTGCAAGGGGCGATGCTGGGGTCCTGGATCAGAA
GACTGCCAGACATTGACCAAGACCATCTGTGCTCCTCAGTGTAATGGTCACTGCTTTGGG
CCCAACCCCAACCAGTGCTGCCATGATGAGTGTGCCGGGGGCTGCTCAGGCCCTCAGGAC
ACAGACTGCTTTGCCTGCCGGCACTTCAATGACAGTGGAGCCTGTGTACCTCGCTGTCCA
CAGCCTCTTGTCTACAACAAGCTAACTTTCCAGCTGGAACCCAATCCCCACACCAAGTAT
CAGTATGGAGGAGTTTGTGTAGCCAGCTGTCCCCATAACTTTGTGGTGGATCAAACATCC
TGTGTCAGGGCCTGTCCTCCTGACAAGATGGAAGTAGATAAAAATGGGCTCAAGATGTGT
GAGCCTTGTGGGGGACTATGTCCCAAAGCCTGTGAGGGAACAGGCTCTGGGAGCCGCTTC
CAGACTGTGGACTCGAGCAACATTGATGGATTTGTGAACTGCACCAAGATCCTGGGCAAC
CTGGACTTTCTGATCACCGGCCTCAATGGAGACCCCTGGCACAAGATCCCTGCCCTGGAC
CCAGAGAAGCTCAATGTCTTCCGGACAGTACGGGAGATCACAGGTTACCTGAACATCCAG
TCCTGGCCGCCCCACATGCACAACTTCAGTGTTTTTTCCAATTTGACAACCATTGGAGGC
AGAAGCCTCTACAACCGGGGCTTCTCATTGTTGATCATGAAGAACTTGAATGTCACATCT
CTGGGCTTCCGATCCCTGAAGGAAATTAGTGCTGGGCGTATCTATATAAGTGCCAATAGG
CAGCTCTGCTACCACCACTCTTTGAACTGGACCAAGGTGCTTCGGGGGCCTACGGAAGAG
CGACTAGACATCAAGCATAATCGGCCGCGCAGAGACTGCGTGGCAGAGGGCAAAGTGTGT
GACCCACTGTGCTCCTCTGGGGGATGCTGGGGCCCAGGCCCTGGTCAGTGCTTGTCCTGT
CGAAATTATAGCCGAGGAGGTGTCTGTGTGACCCACTGCAACTTTCTGAATGGGGAGCCT
CGAGAATTTGCCCATGAGGCCGAATGCTTCTCCTGCCACCCGGAATGCCAACCCATGGAG
GGCACTGCCACATGCAATGGCTCGGGCTCTGATACTTGTGCTCAATGTGCCCATTTTCGA
GATGGGCCCCACTGTGTGAGCAGCTGCCCCCATGGAGTCCTAGGTGCCAAGGGCCCAATC
TACAAGTACCCAGATGTTCAGAATGAATGTCGGCCCTGCCATGAGAACTGCACCCAGGGG
TGTAAAGGACCAGAGCTTCAAGACTGTTTAGGACAAACACTGGTGCTGATCGGCAAAACC
CATCTGACAATGGCTTTGACAGTGATAGCAGGATTGGTAGTGATTTTCATGATGCTGGGC
GGCACTTTTCTCTACTGGCGTGGGCGCCGGATTCAGAATAAAAGGGCTATGAGGCGATAC
TTGGAACGGGGTGAGAGCATAGAGCCTCTGGACCCCAGTGAGAAGGCTAACAAAGTCTTG
GCCAGAATCTTCAAAGAGACAGAGCTAAGGAAGCTTAAAGTGCTTGGCTCGGGTGTCTTT
GGAACTGTGCACAAAGGAGTGTGGATCCCTGAGGGTGAATCAATCAAGATTCCAGTCTGC
ATTAAAGTCATTGAGGACAAGAGTGGACGGCAGAGTTTTCAAGCTGTGACAGATCATATG
CTGGCCATTGGCAGCCTGGACCATGCCCACATTGTAAGGCTGCTGGGACTATGCCCAGGG
TCATCTCTGCAGCTTGTCACTCAATATTTGCCTCTGGGTTCTCTGCTGGATCATGTGAGA
CAACACCGGGGGGCACTGGGGCCACAGCTGCTGCTCAACTGGGGAGTACAAATTGCCAAG
GGAATGTACTACCTTGAGGAACATGGTATGGTGCATAGAAACCTGGCTGCCCGAAACGTG
CTACTCAAGTCACCCAGTCAGGTTCAGGTGGCAGATTTTGGTGTGGCTGACCTGCTGCCT
CCTGATGATAAGCAGCTGCTATACAGTGAGGCCAAGACTCCAATTAAGTGGATGGCCCTT
GAGAGTATCCACTTTGGGAAATACACACACCAGAGTGATGTCTGGAGCTATGGTGTGACA
GTTTGGGAGTTGATGACCTTCGGGGCAGAGCCCTATGCAGGGCTACGATTGGCTGAAGTA
CCAGACCTGCTAGAGAAGGGGGAGCGGTTGGCACAGCCCCAGATCTGCACAATTGATGTC
TACATGGTGATGGTCAAGTGTTGGATGATTGATGAGAACATTCGCCCAACCTTTAAAGAA
CTAGCCAATGAGTTCACCAGGATGGCCCGAGACCCACCACGGTATCTGGTCATAAAGAGA
GAGAGTGGGCCTGGAATAGCCCCTGGGCCAGAGCCCCATGGTCTGACAAACAAGAAGCTA
GAGGAAGTAGAGCTGGAGCCAGAACTAGACCTAGACCTAGACTTGGAAGCAGAGGAGGAC
AACCTGGCAACCACCACACTGGGCTCCGCCCTCAGCCTACCAGTTGGAACACTTAATCGG
CCACGTGGGAGCCAGAGCCTTTTAAGTCCATCATCTGGATACATGCCCATGAACCAGGGT
AATCTTGGGGAGTCTTGCCAGGAGTCTGCAGTTTCTGGGAGCAGTGAACGGTGCCCCCGT
CCAGTCTCTCTACACCCAATGCCACGGGGATGCCTGGCATCAGAGTCATCAGAGGGGCAT
GTAACAGGCTCTGAGGCTGAGCTCCAGGAGAAAGTGTCAATGTGTAGGAGCCGGAGCAGG
AGCCGGAGCCCACGGCCACGCGGAGATAGCGCCTACCATTCCCAGCGCCACAGTCTGCTG
ACTCCTGTTACCCCACTCTCCCCACCCGGGTTAGAGGAAGAGGATGTCAACGGTTATGTC
ATGCCAGATACACACCTCAAAGGTACTCCCTCCTCCCGGGAAGGCACCCTTTCTTCAGTG
GGTCTCAGTTCTGTCCTGGGTACTGAAGAAGAAGATGAAGATGAGGAGTATGAATACATG
AACCGGAGGAGAAGGCACAGTCCACCTCATCCCCCTAGGCCAAGTTCCCTTGAGGAGCTG
GGTTATGAGTACATGGATGTGGGGTCAGACCTCAGTGCCTCTCTGGGCAGCACACAGAGT
TGCCCACTCCACCCTGTACCCATCATGCCCACTGCAGGCACAACTCCAGATGAAGACTAT
GAATATATGAATCGGCAACGAGATGGAGGTGGTCCTGGGGGTGATTATGCAGCCATGGGG
GCCTGCCCAGCATCTGAGCAAGGGTATGAAGAGATGAGAGCTTTTCAGGGGCCTGGACAT
CAGGCCCCCCATGTCCATTATGCCCGCCTAAAAACTCTACGTAGCTTAGAGGCTACAGAC
TCTGCCTTTGATAACCCTGATTACTGGCATAGCAGGCTTTTCCCCAAGGCTAATGCCCAG
AGAACGTAA
Protein Properties
Number of Residues 1342
Molecular Weight 148097.1
Theoretical pI 6.53
Pfam Domain Function
Signals
  • 1-19
Transmembrane Regions
  • 644-664
Protein Sequence
>Receptor tyrosine-protein kinase erbB-3
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNG
RSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEE
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI
YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLG
GTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
LANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEED
NLATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPR
PVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSRSRSPRPRGDSAYHSQRHSLL
TPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM
NRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDY
EYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATD
SAFDNPDYWHSRLFPKANAQRT
GenBank ID Protein 52789419
UniProtKB/Swiss-Prot ID P21860
UniProtKB/Swiss-Prot Entry Name ERBB3_HUMAN
PDB IDs
GenBank Gene ID BC082992
GeneCard ID ERBB3
GenAtlas ID ERBB3
HGNC ID HGNC:3431
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  5. Wolf-Yadlin A, Hautaniemi S, Lauffenburger DA, White FM: Multiple reaction monitoring for robust quantitative proteomic analysis of cellular signaling networks. Proc Natl Acad Sci U S A. 2007 Apr 3;104(14):5860-5. Epub 2007 Mar 26. [PubMed:17389395 ]
  6. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  7. Kraus MH, Issing W, Miki T, Popescu NC, Aaronson SA: Isolation and characterization of ERBB3, a third member of the ERBB/epidermal growth factor receptor family: evidence for overexpression in a subset of human mammary tumors. Proc Natl Acad Sci U S A. 1989 Dec;86(23):9193-7. [PubMed:2687875 ]
  8. Plowman GD, Whitney GS, Neubauer MG, Green JM, McDonald VL, Todaro GJ, Shoyab M: Molecular cloning and expression of an additional epidermal growth factor receptor-related gene. Proc Natl Acad Sci U S A. 1990 Jul;87(13):4905-9. [PubMed:2164210 ]
  9. Katoh M, Yazaki Y, Sugimura T, Terada M: c-erbB3 gene encodes secreted as well as transmembrane receptor tyrosine kinase. Biochem Biophys Res Commun. 1993 May 14;192(3):1189-97. [PubMed:7685162 ]
  10. Lessor TJ, Hamburger AW: Regulation of the ErbB3 binding protein Ebp1 by protein kinase C. Mol Cell Endocrinol. 2001 Apr 25;175(1-2):185-91. [PubMed:11325528 ]
  11. Li Y, Yu WH, Ren J, Chen W, Huang L, Kharbanda S, Loda M, Kufe D: Heregulin targets gamma-catenin to the nucleolus by a mechanism dependent on the DF3/MUC1 oncoprotein. Mol Cancer Res. 2003 Aug;1(10):765-75. [PubMed:12939402 ]
  12. Kinugasa Y, Ishiguro H, Tokita Y, Oohira A, Ohmoto H, Higashiyama S: Neuroglycan C, a novel member of the neuregulin family. Biochem Biophys Res Commun. 2004 Sep 3;321(4):1045-9. [PubMed:15358134 ]
  13. Narkis G, Ofir R, Manor E, Landau D, Elbedour K, Birk OS: Lethal congenital contractural syndrome type 2 (LCCS2) is caused by a mutation in ERBB3 (Her3), a modulator of the phosphatidylinositol-3-kinase/Akt pathway. Am J Hum Genet. 2007 Sep;81(3):589-95. Epub 2007 Jul 24. [PubMed:17701904 ]
  14. Cho HS, Leahy DJ: Structure of the extracellular region of HER3 reveals an interdomain tether. Science. 2002 Aug 23;297(5585):1330-3. Epub 2002 Aug 1. [PubMed:12154198 ]