Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01187
Secondary Accession Numbers
  • 6483
Name V-type proton ATPase subunit G 1
Synonyms
  1. V-ATPase 13 kDa subunit 1
  2. V-ATPase subunit G 1
  3. Vacuolar proton pump subunit G 1
  4. Vacuolar proton pump subunit M16
Gene Name ATP6V1G1
Protein Type Enzyme
Biological Properties
General Function Involved in hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
Specific Function Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells
Pathways Not Available
Reactions Not Available
GO Classification
Component
proton-transporting two-sector atpase complex
proton-transporting v-type atpase complex
vacuolar proton-transporting v-type atpase complex
macromolecular complex
protein complex
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
hydrolase activity, acting on acid anhydrides
Process
hydrogen transport
proton transport
establishment of localization
transport
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:9
Locus 9q32
SNPs ATP6V1G1
Gene Sequence
>357 bp
ATGGCTAGTCAGTCTCAGGGGATTCAGCAGCTGCTGCAGGCCGAGAAGCGGGCAGCCGAG
AAGGTGTCCGAGGCCCGCAAAAGAAAGAACCGGAGGCTGAAGCAGGCCAAAGAAGAAGCT
CAGGCTGAAATTGAACAGTACCGCCTGCAGAGGGAGAAAGAATTCAAGGCCAAGGAAGCT
GCGGCATTGGGATCCCGTGGCAGTTGCAGCACTGAAGTGGAGAAGGAGACCCAGGAGAAG
ATGACCATCCTCCAGACATACTTCCGGCAGAACAGGGATGAAGTCTTGGACAACCTCTTG
GCTTTTGTCTGTGACATTCGGCCAGAAATCCATGAAAACTACCGCATAAATGGATAG
Protein Properties
Number of Residues 118
Molecular Weight 13757.4
Theoretical pI 9.17
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>V-type proton ATPase subunit G 1
MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEA
AALGSRGSCSTEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYRING
GenBank ID Protein 3329378
UniProtKB/Swiss-Prot ID O75348
UniProtKB/Swiss-Prot Entry Name VATG1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF038954
GeneCard ID ATP6V1G1
GenAtlas ID ATP6V1G1
HGNC ID HGNC:864
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  3. Mao M, Fu G, Wu JS, Zhang QH, Zhou J, Kan LX, Huang QH, He KL, Gu BW, Han ZG, Shen Y, Gu J, Yu YP, Xu SH, Wang YX, Chen SJ, Chen Z: Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning. Proc Natl Acad Sci U S A. 1998 Jul 7;95(14):8175-80. [PubMed:9653160 ]
  4. Smith AN, Borthwick KJ, Karet FE: Molecular cloning and characterization of novel tissue-specific isoforms of the human vacuolar H(+)-ATPase C, G and d subunits, and their evaluation in autosomal recessive distal renal tubular acidosis. Gene. 2002 Sep 4;297(1-2):169-77. [PubMed:12384298 ]