You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01200
Secondary Accession Numbers
  • 6496
Name Plasma membrane calcium-transporting ATPase 1
Synonyms
  1. PMCA1
  2. Plasma membrane calcium ATPase isoform 1
  3. Plasma membrane calcium pump isoform 1
Gene Name ATP2B1
Protein Type Unknown
Biological Properties
General Function Involved in ATP binding
Specific Function This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium out of the cell.
Pathways
  • Calcium signaling pathway
  • Endocrine and other factor-regulated calcium reabsorption
  • Mineral absorption
  • Pancreatic secretion
  • Salivary secretion
Reactions Not Available
GO Classification
Biological Process
ATP biosynthetic process
blood coagulation
Cellular Component
integral to plasma membrane
Component
membrane
cell part
Function
di-, tri-valent inorganic cation transmembrane transporter activity
calcium ion transmembrane transporter activity
calcium-transporting atpase activity
binding
catalytic activity
hydrolase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
transporter activity
atpase activity, coupled to transmembrane movement of ions
atpase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
hydrolase activity, acting on acid anhydrides
Molecular Function
metal ion binding
ATP binding
calcium-transporting ATPase activity
Process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
establishment of localization
transport
ion transport
atp biosynthetic process
cation transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 12
Locus 12q21.3
SNPs ATP2B1
Gene Sequence
>3663 bp
ATGGGCGACATGGCAAACAACTCAGTTGCTTACAGTGGTGTGAAAAACTCTTTGAAGGAA
GCTAATCATGATGGAGACTTTGGAATTACGCTCGCAGAGCTGCGGGCTCTCATGGAGCTC
AGGTCCACAGATGCATTACGAAAAATACAGGAAAGCTATGGAGATGTCTATGGAATTTGC
ACCAAATTGAAAACATCTCCCAATGAAGGTTTAAGTGGAAACCCTGCAGATTTAGAAAGA
AGAGAAGCAGTGTTTGGAAAGAATTTTATACCTCCTAAAAAGCCAAAAACCTTTCTTCAA
TTAGTATGGGAAGCATTACAAGATGTCACTTTAATTATATTAGAAATTGCAGCCATAGTA
TCATTGGGCCTTTCTTTTTATCAGCCTCCAGAAGGGGATAATGCACTTTGTGGAGAAGTT
TCTGTTGGGGAGGAAGAAGGTGAAGGTGAAACTGGTTGGATTGAAGGAGCTGCAATCCTC
TTGTCTGTAGTGTGTGTGGTGTTAGTAACAGCTTTCAATGACTGGAGTAAGGAAAAACAG
TTTAGAGGTTTGCAGAGCCGAATTGAACAAGAACAGAAGTTCACTGTCATCAGGGGTGGT
CAGGTCATTCAGATACCTGTAGCTGACATTACTGTTGGAGATATTGCTCAAGTGAAATAT
GGTGATCTTCTTCCAGCTGACGGCATACTTATTCAAGGCAACGATCTTAAAATTGATGAA
AGCTCATTGACTGGTGAATCAGATCATGTTAAAAAGTCTTTAGATAAGGATCCCTTACTT
CTATCAGGTACTCATGTAATGGAAGGCTCTGGAAGAATGGTAGTTACAGCTGTAGGTGTA
AATTCTCAAACTGGAATTATCTTTACCTTACTTGGAGCTGGAGGTGAAGAGGAAGAGAAG
AAAGATGAGAAGAAAAAGGAAAAGAAAAATAAGAAACAAGATGGAGCTATTGAGAATCGC
AACAAAGCAAAAGCCCAGGATGGTGCAGCCATGGAAATGCAGCCATTGAAGAGTGAAGAA
GGTGGAGATGGTGATGAAAAAGATAAAAAGAAAGCAAATTTGCCAAAAAAGGAAAAATCT
GTTTTACAAGGGAAACTTACAAAACTGGCTGTTCAGATTGGCAAAGCAGGTCTGTTGATG
TCTGCCATCACAGTTATCATTCTAGTATTATATTTTGTCATTGACACCTTCTGGGTTCAG
AAAAGACCATGGCTTGCTGAGTGCACACCAATTTATATACAATACTTTGTGAAGTTCTTC
ATTATTGGAGTTACAGTTTTAGTGGTCGCAGTGCCAGAAGGTCTTCCACTTGCAGTCACG
ATCTCACTGGCTTATTCAGTCAAAAAAATGATGAAAGATAATAACTTAGTAAGGCATCTG
GATGCTTGTGAAACCATGGGAAATGCTACAGCTATTTGTTCAGATAAAACAGGAACTTTG
ACAATGAACAGAATGACAGTCGTTCAAGCTTACATAAATGAAAAACATTATAAAAAGGTT
CCTGAACCAGAAGCTATTCCACCAAATATTTTGTCCTATCTTGTAACAGGAATTTCTGTG
AATTGTGCTTATACATCAAAAATATTGCCACCAGAGAAAGAGGGTGGATTACCTCGTCAC
GTTGGTAATAAAACTGAATGTGCCTTGTTGGGACTTCTTTTGGATTTAAAACGGGATTAT
CAGGATGTTAGAAATGAAATACCAGAAGAAGCACTGTACAAAGTCTACACCTTCAATTCT
GTTAGGAAGTCCATGAGTACTGTCCTGAAAAATTCAGATGGAAGTTATCGAATATTCAGC
AAGGGTGCATCTGAGATAATTCTGAAAAAGTGTTTCAAAATCTTGAGTGCTAATGGTGAG
GCAAAAGTATTCAGACCAAGGGACCGTGATGATATTGTAAAAACTGTGATTGAACCGATG
GCATCAGAAGGCTTGAGAACCATATGTCTTGCATTCAGAGATTTTCCAGCAGGAGAACCA
GAACCAGAGTGGGATAATGAAAATGATATTGTCACCGGCCTTACATGCATTGCTGTTGTG
GGGATTGAAGATCCTGTGAGACCTGAGGTGCCAGATGCAATTAAAAAGTGTCAGAGGGCT
GGAATTACTGTGCGGATGGTCACTGGTGATAATATTAATACTGCTCGGGCCATTGCTACC
AAATGTGGTATTTTACATCCTGGGGAAGATTTTCTGTGCCTAGAAGGTAAAGATTTTAAC
AGAAGAATACGAAATGAAAAAGGAGAGATTGAGCAAGAGAGGATAGACAAGATTTGGCCA
AAACTTCGAGTACTTGCAAGATCATCTCCTACTGATAAGCATACACTGGTTAAAGGTATA
ATTGACAGCACTGTCTCAGACCAACGCCAGGTTGTAGCTGTAACTGGTGATGGTACAAAT
GATGGCCCAGCACTAAAGAAAGCAGATGTTGGATTTGCAATGGGTATTGCTGGAACTGAT
GTAGCTAAAGAAGCATCCGATATTATTCTCACAGATGACAACTTTACAAGCATTGTTAAA
GCAGTTATGTGGGGACGAAATGTCTATGACAGCATCTCAAAATTCCTTCAGTTCCAACTT
ACTGTTAATGTAGTAGCAGTGATTGTTGCTTTTACGGGCGCCTGCATTACTCAAGACTCA
CCGCTTAAGGCTGTGCAGATGCTGTGGGTAAACCTCATAATGGATACACTCGCTTCCCTG
GCTCTGGCAACGGAACCACCCACTGAGTCTCTCTTGCTTCGGAAACCTTATGGTAGAAAT
AAGCCTCTCATCTCACGTACAATGATGAAGAATATTTTGGGTCATGCATTCTATCAACTT
GTAGTAGTCTTTACACTCTTATTTGCTGGAGAAAAGTTTTTTGACATTGATAGTGGAAGA
AATGCTCCTTTGCATGCTCCTCCTTCAGAACATTATACTATTGTTTTTAATACCTTTGTG
CTGATGCAACTTTTCAACGAAATAAATGCCCGGAAAATTCATGGTGAAAGAAATGTATTC
GAAGGAATCTTTAACAATGCCATCTTCTGCACAATTGTTTTAGGCACTTTTGTGGTACAG
ATAATAATTGTGCAGTTTGGTGGAAAACCTTTCAGTTGTTCAGAACTTTCAATAGAACAG
TGGCTATGGTCAATATTCCTAGGAATGGGAACATTACTCTGGGGCCAGCTTATTTCAACA
ATTCCAACTAGCCGTTTAAAATTCCTCAAAGAAGCTGGTCATGGAACACAAAAGGAAGAA
ATACCTGAGGAGGAATTAGCAGAGGATGTTGAAGAGATTGATCACGCTGAAAGGGAGTTG
CGGCGTGGCCAAATCTTGTGGTTTAGAGGTCTGAACAGAATCCAAACACAGATTCGAGTG
GTGAATGCATTTCGTAGTTCTTTATATGAAGGGTTAGAAAAACCGGAATCAAGAAGTTCG
ATTCACAACTTTATGACACATCCTGAGTTTAGGATAGAAGATTCAGAGCCTCATATCCCC
CTTATTGATGACACTGATGCCGAAGATGATGCTCCTACAAAACGTAACTCCAGTCCTCCA
CCCTCTCCCAACAAAAATAACAATGCTGTTGACAGTGGAATTCACCTTACAATAGAAATG
AACAAGTCTGCTACCTCTTCATCCCCAGGAAGCCCACTACATAGTTTGGAAACATCACTC
TGA
Protein Properties
Number of Residues 1258
Molecular Weight 129515.035
Theoretical pI 6.166
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Plasma membrane calcium-transporting ATPase 1
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGIC
TKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIV
SLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDE
SSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEK
KDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFF
IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTL
TMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFS
KGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEP
EPEWDNENDIVTGLTCIAVVGIEDPVRPEVPDAIKKCQRAGITVRMVTGDNINTARAIAT
KCGILHPGEDFLCLEGKDFNRRIRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGI
IDSTVSDQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVK
AVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASL
ALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDSGR
NAPLHAPPSEHYTIVFNTFVLMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFVVQ
IIIVQFGGKPFSCSELSIEQWLWSIFLGMGTLLWGQLISTIPTSRLKFLKEAGHGTQKEE
IPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQMDVVNAFQSGSSIQGALRRQPSI
ASQHHDVTNISTPTHIRVVNAFRSSLYEGLEKPESRSSIHNFMTHPEFRIEDSEPHIPLI
DDTDAEDDAPTKRNSSPPPSPNKNNNAVDSGIHLTIEMNKSATSSSPGSPLHSLETSL
GenBank ID Protein 48255945
UniProtKB/Swiss-Prot ID P20020
UniProtKB/Swiss-Prot Entry Name AT2B1_HUMAN
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID ATP2B1
GenAtlas ID ATP2B1
HGNC ID HGNC:814
References
General References
  1. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  2. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  3. Stauffer TP, Hilfiker H, Carafoli E, Strehler EE: Quantitative analysis of alternative splicing options of human plasma membrane calcium pump genes. J Biol Chem. 1993 Dec 5;268(34):25993-6003. [PubMed:8245032 ]
  4. Stauffer TP, Hilfiker H, Carafoli E, Strehler EE: Quantitative analysis of alternative splicing options of human plasma membrane calcium pump genes. J Biol Chem. 1994 Dec 16;269(50):32022. [PubMed:7989379 ]
  5. Verma AK, Filoteo AG, Stanford DR, Wieben ED, Penniston JT, Strehler EE, Fischer R, Heim R, Vogel G, Mathews S, et al.: Complete primary structure of a human plasma membrane Ca2+ pump. J Biol Chem. 1988 Oct 5;263(28):14152-9. [PubMed:2844759 ]
  6. Kumar R, Haugen JD, Penniston JT: Molecular cloning of a plasma membrane calcium pump from human osteoblasts. J Bone Miner Res. 1993 Apr;8(4):505-13. [PubMed:8386431 ]
  7. Hilfiker H, Strehler-Page MA, Stauffer TP, Carafoli E, Strehler EE: Structure of the gene encoding the human plasma membrane calcium pump isoform 1. J Biol Chem. 1993 Sep 15;268(26):19717-25. [PubMed:8396145 ]
  8. Strehler EE, Strehler-Page MA, Vogel G, Carafoli E: mRNAs for plasma membrane calcium pump isoforms differing in their regulatory domain are generated by alternative splicing that involves two internal donor sites in a single exon. Proc Natl Acad Sci U S A. 1989 Sep;86(18):6908-12. [PubMed:2528729 ]
  9. Kessler F, Falchetto R, Heim R, Meili R, Vorherr T, Strehler EE, Carafoli E: Study of calmodulin binding to the alternatively spliced C-terminal domain of the plasma membrane Ca2+ pump. Biochemistry. 1992 Dec 1;31(47):11785-92. [PubMed:1332771 ]
  10. Howard A, Legon S, Walters JR: Human and rat intestinal plasma membrane calcium pump isoforms. Am J Physiol. 1993 Nov;265(5 Pt 1):G917-25. [PubMed:7694502 ]
  11. James PH, Pruschy M, Vorherr TE, Penniston JT, Carafoli E: Primary structure of the cAMP-dependent phosphorylation site of the plasma membrane calcium pump. Biochemistry. 1989 May 16;28(10):4253-8. [PubMed:2548572 ]
  12. Wang KK, Wright LC, Machan CL, Allen BG, Conigrave AD, Roufogalis BD: Protein kinase C phosphorylates the carboxyl terminus of the plasma membrane Ca(2+)-ATPase from human erythrocytes. J Biol Chem. 1991 May 15;266(14):9078-85. [PubMed:1827443 ]
  13. Benkwitz C, Kubisch C, Kraft K, Neyses L: Investigation of the Met-267 Arg exchange in isoform 1 of the human plasma membrane calcium pump in patients with essential hypertension by the amplification-created restriction site technique. J Mol Med (Berl). 1997 Jan;75(1):62-6. [PubMed:9020386 ]