Showing Protein Sodium/potassium-transporting ATPase subunit beta-2 (HMDBP01224)

• 6520

1. Sodium/potassium-dependent ATPase subunit beta-2

• 3-Methylthiofentanyl Action Pathway
• Acebutolol Action Pathway
• Alfentanil Action Pathway
• Alprenolol Action Pathway
• Alvimopan Action Pathway
• Amiloride Action Pathway
• Amiodarone Action Pathway
• Amlodipine Action Pathway
• Anileridine Action Pathway
• Arbutamine Action Pathway
• Atenolol Action Pathway
• Bendroflumethiazide Action Pathway
• Benzocaine Action Pathway
• Betaxolol Action Pathway
• Bevantolol Action Pathway
• Bisoprolol Action Pathway
• Blue diaper syndrome
• Bopindolol Action Pathway
• Bumetanide Action Pathway
• Bupivacaine Action Pathway
• Bupranolol Action Pathway
• Buprenorphine Action Pathway
• Carfentanil Action Pathway
• Carteolol Action Pathway
• Carvedilol Action Pathway
• Chloroprocaine Action Pathway
• Chlorothiazide Action Pathway
• Chlorthalidone Action Pathway
• Citalopram Action Pathway
• Cocaine Action Pathway
• Codeine Action Pathway
• Cyclothiazide Action Pathway
• Cystinuria
• Desipramine Action Pathway
• Dezocine Action Pathway
• Dibucaine Action Pathway
• Dihydromorphine Action Pathway
• Diltiazem Action Pathway
• Dimethylthiambutene Action Pathway
• Diphenoxylate Action Pathway
• Disopyramide Action Pathway
• Dobutamine Action Pathway
• Epinephrine Action Pathway
• Eplerenone Action Pathway
• Escitalopram Action Pathway
• Esmolol Action Pathway
• Ethacrynic Acid Action Pathway
• Ethylmorphine Action Pathway
• Felodipine Action Pathway
• Fentanyl Action Pathway
• Flecainide Action Pathway
• Fluoxetine Action Pathway
• Fosphenytoin (Antiarrhythmic) Action Pathway
• Furosemide Action Pathway
• Glucose Transporter Defect (SGLT2)
• Hartnup Disorder
• Heroin Action Pathway
• Hydrochlorothiazide Action Pathway
• Hydrocodone Action Pathway
• Hydroflumethiazide Action Pathway
• Hydromorphone Action Pathway
• Ibutilide Action Pathway
• Iminoglycinuria
• Imipramine Action Pathway
• Indapamide Action Pathway
• Isoprenaline Action Pathway
• Isradipine Action Pathway
• Ketobemidone Action Pathway
• Kidney Function
• Labetalol Action Pathway
• Lactose Degradation
• Lactose Intolerance
• Levallorphan Action Pathway
• Levobunolol Action Pathway
• Levobupivacaine Action Pathway
• Levomethadyl Acetate Action Action Pathway
• Levorphanol Action Pathway
• Lidocaine (Antiarrhythmic) Action Pathway
• Lidocaine (Local Anaesthetic) Action Pathway
• Lysinuric Protein Intolerance
• Lysinuric protein intolerance (LPI)
• Mepivacaine Action Pathway
• Methadone Action Pathway
• Methadyl Acetate Action Pathway
• Methyclothiazide Action Pathway
• Metipranolol Action Pathway
• Metolazone Action Pathway
• Metoprolol Action Pathway
• Mexiletine Action Pathway
• Morphine Action Pathway
• Muscle/Heart Contraction
• Nadolol Action Pathway
• Nalbuphine Action Pathway
• Naloxone Action Pathway
• Naltrexone Action Pathway
• Nebivolol Action Pathway
• Nicotine Action Pathway
• Nifedipine Action Pathway
• Nimodipine Action Pathway
• Nisoldipine Action Pathway
• Nitrendipine Action Pathway
• Oxprenolol Action Pathway
• Oxybuprocaine Action Pathway
• Oxycodone Action Pathway
• Oxymorphone Action Pathway
• Penbutolol Action Pathway
• Pentazocine Action Pathway
• Phenytoin (Antiarrhythmic) Action Pathway
• Pindolol Action Pathway
• Polythiazide Action Pathway
• Practolol Action Pathway
• Prilocaine Action Pathway
• Procainamide (Antiarrhythmic) Action Pathway
• Procaine Action Pathway
• Proparacaine Action Pathway
• Propoxyphene Action Pathway
• Propranolol Action Pathway
• Quinethazone Action Pathway
• Quinidine Action Pathway
• Remifentanil Action Pathway
• Ropivacaine Action Pathway
• Sotalol Action Pathway
• Spironolactone Action Pathway
• Sufentanil Action Pathway
• Timolol Action Pathway
• Tocainide Action Pathway
• Torsemide Action Pathway
• Tramadol Action Action Pathway
• Trehalose Degradation
• Triamterene Action Pathway
• Trichlormethiazide Action Pathway
• Verapamil Action Pathway

1. Membrane
2. Single-pass type II membrane protein

>873 bp
ATGGTCATCCAGAAAGAGAAGAAGAGCTGCGGGCAGGTGGTTGAGGAGTGGAAGGAGTTC
GTGTGGAACCCGAGGACGCACCAGTTTATGGGCCGCACCGGGACCAGCTGGGCCTTTATC
CTCCTCTTCTACCTCGTTTTTTATGGGTTCCCCACCGCCATGTTCACCCTCACCATGTGG
GTGATGCTGCAGACTGTCTCCGACCATACCCCCAAGTACCAGGACCGACTGGCCACACCG
GGCTTGATGATTCGCCCCAAGACTGAGAACCTTGATGTCATTGTCAATGTCAGTGACACT
GAAAGCTGGGACCAGCATGTTCAGAAGCTCAACAAGTTCTTGGAGCCTTACAACGACTCT
ATGCAAGCCCAAAAGAATGATGTCTGCCGCCCTGGGCGCTATTACGAACAGCCAGATAAT
GGAGTCCTCAACTACCCCAAACTGGCCTGCCAATTCAACCGGACCCAGCTGGGCAACTGC
TCCGGCATTGGGGACTCCACCCACTATGGTTACAGCACTGGGCAGCCCTGTGTCTTCATC
AAGATGAACCGGGTCATCAACTTCTATGCAGGAGCAAACCAGAGCATGAATGTTACCTGT
GCTGGGAAGCGAGATGAAGATGCTGAGAATCTCGGCAACTTCGTCATGTTCCCCGCCAAC
GGCAACATCGACCTCATGTACTTCCCCTACTATGGCAAAAAGTTCCACGTGAACTACACA
CAGCCCCTGGTGGCTGTGAAGTTCCTGAATGTGACCCCCAACGTGGAGGTGAATGTAGAA
TGTCGCATCAACGCCGCCAACATCGCCACAGACGATGAGCGAGACAAGTTCGCCGGCCGC
GTGGCCTTCAAACTCCGCATCAACAAAACCTGA

• Na_K-ATPase (PF00287 )

• None

• 40-67

>Sodium/potassium-transporting ATPase subunit beta-2
MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMW
VMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDS
IQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFI
KMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYT
QPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT

1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
4. Martin-Vasallo P, Dackowski W, Emanuel JR, Levenson R: Identification of a putative isoform of the Na,K-ATPase beta subunit. Primary structure and tissue-specific expression. J Biol Chem. 1989 Mar 15;264(8):4613-8. [PubMed:2538450 ]
5. Hernando N, Martin-Vasallo P, Ghosh S, Ghosh PK, Swaroop A, Coca-Prados M: Nucleotide sequence of a cDNA for the beta 2 subunit isoform of Na+,K(+)-ATPase from human retina. Biochim Biophys Acta. 1994 Jan 3;1189(1):109-11. [PubMed:8305453 ]
6. Ruiz A, Bhat SP, Bok D: Expression and synthesis of the Na,K-ATPase beta 2 subunit in human retinal pigment epithelium. Gene. 1996 Oct 17;176(1-2):237-42. [PubMed:8918259 ]
7. Avila J, Alvarez de la Rosa D, Gonzalez-Martinez LM, Lecuona E, Martin-Vasallo P: Structure and expression of the human Na,K-ATPase beta 2-subunit gene. Gene. 1998 Feb 27;208(2):221-7. [PubMed:9524271 ]