You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01230
Secondary Accession Numbers
  • 6526
Name Proto-oncogene tyrosine-protein kinase Yes
Synonyms
  1. Proto-oncogene c-Yes
  2. p61-Yes
Gene Name YES1
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function Promotes infectivity of Neisseria gonorrhoeae in epithelial cells by phosphorylating MCP/CD46
Pathways Not Available
Reactions Not Available
GO Classification
Function
protein tyrosine kinase activity
non-membrane spanning protein tyrosine kinase activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Cytoplasm
  2. cytosol
Gene Properties
Chromosome Location Chromosome:1
Locus 18p11.31-p11.21
SNPs YES1
Gene Sequence
>1632 bp
ATGGGCTGCATTAAAAGTAAAGAAAACAAAAGTCCAGCCATTAAATACAGACCTGAAAAT
ACTCCAGAGCCTGTCAGTACAAGTGTGAGCCATTATGGAGCAGAACCCACTACAGTGTCA
CCATGTCCGTCATCTTCAGCAAAGGGAACAGCAGTTAATTTCAGCAGTCTTTCCATGACA
CCATTTGGAGGATCCTCAGGGGTAACGCCTTTTGGAGGTGCATCTTCCTCATTTTCAGTG
GTGCCAAGTTCATATCCTGCTGGTTTAACAGGTGGTGTTACTATATTTGTGGCCTTATAT
GATTATGAAGCTAGAACTACAGAAGACCTTTCATTTAAGAAGGGTGAAAGATTTCAAATA
ATTAACAATACGGAAGGAGATTGGTGGGAAGCAAGATCAATCGCTACAGGAAAGAATGGT
TATATCCCGAGCAATTATGTAGCGCCTGCAGATTCCATTCAGGCAGAAGAATGGTATTTT
GGCAAAATGGGGAGAAAAGATGCTGAAAGATTACTTTTGAATCCTGGAAATCAACGAGGT
ATTTTCTTAGTAAGAGAGAGTGAAACAACTAAAGGTGCTTATTCCCTTTCTATTCGTGAT
TGGGATGAGATAAGGGGTGACAATGTGAAACACTACAAAATTAGGAAACTTGACAATGGT
GGATACTATATCACAACCAGAGCACAATTTGATACTCTGCAGAAATTGGTGAAACACTAC
ACAGAACATGCTGATGGTTTATGCCACAAGTTGACAACTGTGTGTCCAACTGTGAAACCT
CAGACTCAAGGTCTAGCAAAAGATGCTTGGGAAATCCCTCGAGAATCTTTGCGACTAGAG
GTTAAACTAGGACAAGGATGTTTCGGCGAAGTGTGGATGGGAACATGGAATGGAACCACG
AAAGTAGCAATCAAAACACTAAAACCAGGTACAATGATGCCAGAAGCTTTCCTTCAAGAA
GCTCAGATAATGAAAAAATTAAGACATGATAAACTTGTTCCACTATATGCTGTTGTTTCT
GAAGAACCAATTTACATTGTCACTGAATTTATGTCAAAAGGAAGCTTATTAGATTTCCTT
AAGGAAGGAGATGGAAAGTATTTGAAGCTTCCACAGCTGGTTGATATGGCTGCTCAGATT
GCTGATGGTATGGCATATATTGAAAGAATGAACTATATTCACCGAGATCTTCGGGCTGCT
AATATTCTTGTAGGAGAAAATCTTGTGTGCAAAATAGCAGACTTTGGTTTAGCAAGGTTA
ATTGAAGACAATGAATACACAGCAAGACAAGGTGCAAAATTTCCAATCAAATGGACAGCT
CCTGAAGCTGCACTGTATGGTCGGTTTACAATAAAGTCTGATGTCTGGTCATTTGGAATT
CTGCAAACAGAACTAGTAACAAAGGGCCGAGTGCCATATCCAGGTATGGTGAACCGTGAA
GTACTAGAACAAGTGGAGCGAGGATACAGGATGCCGTGCCCTCAGGGCTGTCCAGAATCC
CTCCATGAATTGATGAATCTGTGTTGGAAGAAGGACCCTGATGAAAGACCAACATTTGAA
TATATTCAGTCCTTCTTGGAAGACTACTTCACTGCTACAGAGCCACAGTACCAGCCAGGA
GAAAATTTATAA
Protein Properties
Number of Residues 543
Molecular Weight 60800.8
Theoretical pI 6.71
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Proto-oncogene tyrosine-protein kinase Yes
MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMT
PFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQI
INNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRG
IFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHY
TEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTT
KVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFL
KEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARL
IEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNRE
VLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPG
ENL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P07947
UniProtKB/Swiss-Prot Entry Name YES_HUMAN
PDB IDs Not Available
GenBank Gene ID M15990
GeneCard ID YES1
GenAtlas ID YES1
HGNC ID HGNC:12841
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [PubMed:15592455 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  8. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  9. Zhang Y, Wolf-Yadlin A, Ross PL, Pappin DJ, Rush J, Lauffenburger DA, White FM: Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules. Mol Cell Proteomics. 2005 Sep;4(9):1240-50. Epub 2005 Jun 11. [PubMed:15951569 ]
  10. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  11. Tao WA, Wollscheid B, O'Brien R, Eng JK, Li XJ, Bodenmiller B, Watts JD, Hood L, Aebersold R: Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry. Nat Methods. 2005 Aug;2(8):591-8. [PubMed:16094384 ]
  12. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  13. Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. Mol Cell Proteomics. 2007 Mar;6(3):537-47. Epub 2006 Dec 27. [PubMed:17192257 ]
  14. Nusbaum C, Zody MC, Borowsky ML, Kamal M, Kodira CD, Taylor TD, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Abouelleil A, Allen NR, Anderson S, Bloom T, Bugalter B, Butler J, Cook A, DeCaprio D, Engels R, Garber M, Gnirke A, Hafez N, Hall JL, Norman CH, Itoh T, Jaffe DB, Kuroki Y, Lehoczky J, Lui A, Macdonald P, Mauceli E, Mikkelsen TS, Naylor JW, Nicol R, Nguyen C, Noguchi H, O'Leary SB, O'Neill K, Piqani B, Smith CL, Talamas JA, Topham K, Totoki Y, Toyoda A, Wain HM, Young SK, Zeng Q, Zimmer AR, Fujiyama A, Hattori M, Birren BW, Sakaki Y, Lander ES: DNA sequence and analysis of human chromosome 18. Nature. 2005 Sep 22;437(7058):551-5. [PubMed:16177791 ]
  15. Sukegawa J, Semba K, Yamanashi Y, Nishizawa M, Miyajima N, Yamamoto T, Toyoshima K: Characterization of cDNA clones for the human c-yes gene. Mol Cell Biol. 1987 Jan;7(1):41-7. [PubMed:2436037 ]
  16. Lee SW, Bonnah RA, Higashi DL, Atkinson JP, Milgram SL, So M: CD46 is phosphorylated at tyrosine 354 upon infection of epithelial cells by Neisseria gonorrhoeae. J Cell Biol. 2002 Mar 18;156(6):951-7. Epub 2002 Mar 18. [PubMed:11901164 ]
  17. Martin-Garcia JM, Luque I, Mateo PL, Ruiz-Sanz J, Camara-Artigas A: Crystallographic structure of the SH3 domain of the human c-Yes tyrosine kinase: loop flexibility and amyloid aggregation. FEBS Lett. 2007 May 1;581(9):1701-6. Epub 2007 Mar 30. [PubMed:17418139 ]