Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01243
Secondary Accession Numbers
  • 6539
Name MAP/microtubule affinity-regulating kinase 4
Synonyms
  1. MAP/microtubule affinity-regulating kinase-like 1
Gene Name MARK4
Protein Type Enzyme
Biological Properties
General Function Involved in protein serine/threonine kinase activity
Specific Function ATP + a protein = ADP + a phosphoprotein
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.3
SNPs MARK4
Gene Sequence
>2259 bp
ATGTCTTCGCGGACGGTGCTGGCCCCGGGCAACGATCGGAACTCGGACACGCATGGCACC
TTGGGCAGTGGCCGCTCCTCGGACAAAGGCCCGTCCTGGTCCAGCCGCTCACTGGGTGCC
CGTTGCCGGAACTCCATCGCCTCCTGTCCCGAGGAGCAGCCCCACGTGGGCAACTACCGC
CTGCTGAGGACCATTGGGAAGGGCAACTCTGCCAAAGTCAAGCTGGCTCGGCACATCCTC
ACTGGTCGGGAGGTTGCCATCAAGATTATCGACAAAACCCAGCTGAATCCCAGCAGCCTG
CAGAAGCTGTTCCGAGAAGTCCGCATCATGAAGGGCCTAAACCACCCCAACATCGTGAAG
CTCTTTGAGGTGATTGAGACTGAGAAGACGCTGTACCTGGTGATGGAGTACGCAAGTGCT
GGAGAAGTGTTTGACTACCTCGTGTCGCATGGCCGCATGAAGGAGAAGGAAGCTCGAGCC
AAGTTCCGACAGATTGTTTCGGCTGTGCACTATTGTCACCAGAAAAATATTGTACACAGG
GACCTGAAGGCTGAGAACCTCTTGCTGGATGCCGAGGCCAACATCAAGATTGCTGACTTT
GGCTTCAGCAACGAGTTCACGCTGGGATCGAAGCTGGACACGTTCTGCGGGAGCCCCCCA
TATGCCGCCCCGGAGCTGTTTCAGGGCAAGAAGTACGACGGGCCGGAGGTGGACATCTGG
AGCCTGGGAGTCATCCTGTACACCCTCGTCAGCGGCTCCCTGCCCTTCGACGGGCACAAC
CTCAAGGAGCTGCGGGAGCGAGTACTCAGAGGGAAGTACCGGGTCCCTTTCTACATGTCA
ACAGACTGTGAGAGCATCCTGCGGAGATTTTTGGTGCTGAACCCAGCTAAACGCTGTACT
CTCGAGCAAATCATGAAAGACAAATGGATCAACATCGGCTATGAGGGTGAGGAGTTGAAG
CCATACACAGAGCCCGAGGAGGACTTCGGGGACACCAAGAGAATTGAGGTGATGGTGGGT
ATGGGCTACACACGGGAAGAAATCAAAGAGTCCTTGACCAGCCAGAAGTACAACGAAGTG
ACCGCCACCTACCTCCTGCTGGGCAGGAAGACTGAGGAGGGTGGGGACCGGGGCGCCCCA
GGGCTGGCCCTGGCACGGGTGCGGGCGCCCAGCGACACCACCAACGGAACAAGTTCCAGC
AAAGGCACCAGCCACAGCAAAGGGCAGCGGAGTTCCTCTTCCACCTACCACCGCCAGCGC
AGGCATAGCGATTTCTGTGGCCCATCCCCTGCACCCCTGCACCCCAAACGCAGCCCGACG
AGCACGGGGGAGGCGGAGCTGAAGGAGGAGCGGCTGCCAGGCCGGAAGGCGAGCTGCAGC
ACCGCGGGGAGTGGGAGTCGAGGGCTGCCCCCCTCCAGCCCCATGGTCAGCAGCGCCCAC
AACCCCAACAAGGCAGAGATCCCAGAGCGGCGGAAGGACAGCACGAGCACCCCCAACAAC
CTCCCTCCTAGCATGATGACCCGCAGAAACACCTACGTTTGCACAGAACGCCCGGGGGCT
GAGCGCCCGTCACTGTTGCCAAATGGGAAAGAAAACAGCTCAGGCACCCCACGGGTGCCC
CCTGCCTCCCCCTCCAGTCACAGCCTGGCACCCCCATCAGGGGAGCGGAGCCGCCTGGCA
CGCGGTTCCACCATCCGCAGCACCTTCCATGGTGGCCAGGTCCGGGACCGGCGGGCAGGG
GGTGGGGGTGGTGGGGGTGTGCAGAATGGGCCCCCTGCCTCTCCCACACTGGCCCATGAG
GCTGCACCCCTGCCCGCCGGGCGGCCCCGCCCCACCACCAACCTCTTCACCAAGCTGACC
TCCAAACTGACCCGAAGGGTCGCAGACGAACCTGAGAGAATCGGGGGACCTGAGGTCACA
AGTTGCCATCTACCTTGGGATCAAACGGAAACCGCCCCCCGGCTGCTCCGATTCCCCTGG
AGTGTGAAGCTGACCAGCTCGCGCCCTCCTGAGGCCCTGATGGCAGCTCTGCGCCAGGCC
ACAGCAGCCGCCCGCTGCCGCTGCCGCCAGCCACAGCCGTTCCTGCTGGCCTGCCTGCAC
GGGGGTGCGGGCGGGCCCGAGCCCCTGTCCCACTTCGAAGTGGAGGTCTGCCAGCTGCCC
CGGCCAGGCTTGCGGGGAGTTCTCTTCCGCCGTGTGGCGGGCACCGCCCTGGCCTTCCGC
ACCCTCGTCACCCGCATCTCCAACGACCTCGAGCTCTGA
Protein Properties
Number of Residues 752
Molecular Weight 82518.9
Theoretical pI 10.18
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>MAP/microtubule affinity-regulating kinase 4
MSSRTVLAPGNDRNSDTHGTLGSGRSSDKGPSWSSRSLGARCRNSIASCPEEQPHVGNYR
LLRTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPSSLQKLFREVRIMKGLNHPNIVK
LFEVIETEKTLYLVMEYASAGEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHR
DLKAENLLLDAEANIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIW
SLGVILYTLVSGSLPFDGHNLKELRERVLRGKYRVPFYMSTDCESILRRFLVLNPAKRCT
LEQIMKDKWINIGYEGEELKPYTEPEEDFGDTKRIEVMVGMGYTREEIKESLTSQKYNEV
TATYLLLGRKTEEGGDRGAPGLALARVRAPSDTTNGTSSSKGTSHSKGQRSSSSTYHRQR
RHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSTAGSGSRGLPPSSPMVSSAH
NPNKAEIPERRKDSTSTPNNLPPSMMTRRNTYVCTERPGAERPSLLPNGKENSSGTPRVP
PASPSSHSLAPPSGERSRLARGSTIRSTFHGGQVRDRRAGGGGGGGVQNGPPASPTLAHE
AAPLPAGRPRPTTNLFTKLTSKLTRRVADEPERIGGPEVTSCHLPWDQTETAPRLLRFPW
SVKLTSSRPPEALMAALRQATAAARCRCRQPQPFLLACLHGGAGGPEPLSHFEVEVCQLP
RPGLRGVLFRRVAGTALAFRTLVTRISNDLEL
GenBank ID Protein 21743250
UniProtKB/Swiss-Prot ID Q96L34
UniProtKB/Swiss-Prot Entry Name MARK4_HUMAN
PDB IDs Not Available
GenBank Gene ID AB088047
GeneCard ID MARK4
GenAtlas ID MARK4
HGNC ID HGNC:13538
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  3. Nagase T, Nakayama M, Nakajima D, Kikuno R, Ohara O: Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2001 Apr 27;8(2):85-95. [PubMed:11347906 ]
  4. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  5. Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. Mol Cell Proteomics. 2007 Mar;6(3):537-47. Epub 2006 Dec 27. [PubMed:17192257 ]
  6. Kato T, Satoh S, Okabe H, Kitahara O, Ono K, Kihara C, Tanaka T, Tsunoda T, Yamaoka Y, Nakamura Y, Furukawa Y: Isolation of a novel human gene, MARKL1, homologous to MARK3 and its involvement in hepatocellular carcinogenesis. Neoplasia. 2001 Jan-Feb;3(1):4-9. [PubMed:11326310 ]
  7. Al-Hakim AK, Zagorska A, Chapman L, Deak M, Peggie M, Alessi DR: Control of AMPK-related kinases by USP9X and atypical Lys(29)/Lys(33)-linked polyubiquitin chains. Biochem J. 2008 Apr 15;411(2):249-60. doi: 10.1042/BJ20080067. [PubMed:18254724 ]