Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01252
Secondary Accession Numbers
  • 6548
Name Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit beta
Synonyms
  1. C2-PI3K
  2. PI3K-C2-beta
  3. Phosphoinositide 3-kinase-C2-beta
  4. PtdIns-3-kinase C2 subunit beta
Gene Name PIK3C2B
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Phosphorylates PtdIns and PtdIns4P with a preference for PtdIns. Does not phosphorylate PtdIns(4,5)P2. May be involved in EGF and PDGF signaling cascades
Pathways Not Available
Reactions Not Available
GO Classification
Component
macromolecular complex
protein complex
phosphoinositide 3-kinase complex
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
phosphotransferase activity, alcohol group as acceptor
protein binding
inositol or phosphatidylinositol kinase activity
lipid binding
phospholipid binding
phosphoinositide binding
lipid kinase activity
phosphoinositide 3-kinase activity
1-phosphatidylinositol-3-kinase activity
Process
metabolic process
cellular process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signal transduction
organophosphate metabolic process
phospholipid metabolic process
cell communication
second-messenger-mediated signaling
phosphoinositide-mediated signaling
glycerophospholipid metabolic process
phosphoinositide metabolic process
phosphoinositide phosphorylation
Cellular Location
  1. Cell membrane
  2. Nucleus
  3. Cytoplasm
  4. Microsome
  5. Endoplasmic reticulum
  6. cytosol
Gene Properties
Chromosome Location Chromosome:1
Locus 1q32
SNPs PIK3C2B
Gene Sequence
>4905 bp
ATGTCTTCGACTCAGGACAATGGGGAACACTGGAAGTCCCTGGAGTCTGTGGGCATCAGC
CGCAAAGAACTAGCGATGGCCGAAGCCCTGCAGATGGAGTATGATGCCCTGTCCCGGCTC
CGGCATGACAAGGAGGAGAACAGAGCCAAGCAGAACGCAGACCCCTCTCTCATCAGCTGG
GATGAGCCTGGGGTAGACTTTTACAGCAAGCCAGCAGGAAGGCGGACCGACCTCAAGCTG
TTACGCGGTCTCTCTGGCTCTGATCCTACCCTTAACTACAACTCACTATCCCCACAGGAA
GGGCCGCCCAACCACTCTACCTCCCAAGGGCCACAGCCTGGCTCAGATCCCTGGCCCAAA
GGCTCCCTGTCTGGAGACTATCTCTACATTTTTGATGGTTCAGATGGGGGAGTCTCTTCG
TCCCCAGGACCAGGGGACATAGAGGGCTCTTGCAAGAAACTATCCCCACCTCCTCTGCCT
CCCCGAGCTTCTATCTGGGATACCCCTCCCCTGCCTCCCAGAAAGGGGTCCCCCTCATCC
TCCAAGATCTCCCAGCCCAGTGACATCAACACTTTCTCTTTGGTCGAACAATTGCCAGGC
AAACTGCTAGAGCATCGGATCCTAGAAGAGGAAGAGGTGCTGGGAGGTGGGGGTCAGGGG
CGCCTACTGGGGTCTGTGGACTATGATGGTATCAATGATGCAATTACTAGGCTCAACTTG
AAATCGACCTATGATGTGGAGATGTTGCGGGATGCCACCAGGGGCTGGAAGGAGGGCCGA
GGGCCGCTGGACTTCAGCAAAGACACCTCTGGAAAACCCGTGGCCAGGAGCAAGACTATG
CCCCCTCAGGTGCCCCCCCGCACCTATGCCTCCCGCTATGGCAACCGAAAGAATGCGACG
CCTGGCAAGAACCGCCGGATTTCTGCAGCCCCGGTGGGCTCCCGGCCCCACACTGTTGCC
AATGGCCATGAGTTGTTTGAGGTCTCAGAAGAGAGAGATGAGGAGGTTGCTGCATTTTGC
CACATGCTGGATATCCTTCGATCTGGCTCTGACATCCAAGACTACTTCCTCACTGGCTAT
GTCTGGAGTGCTGTCACCCCTAGCCCAGAGCACCTCGGGGATGAGGTCAACCTGAAGGTG
ACTGTGTTGTGTGACAGGCTTCAAGAGGCACTCACTTTCACCTGCAACTGTTCCTCCACT
GTAGACTTGCTTATCTACCAGACCCTGTGCTACACCCATGATGACCTGAGGAATGTGGAC
GTGGGTGACTTTGTGCTAAAGCCCTGCGGGCTGGAGGAGTTCCTGCAGAACAAGCATGCC
TTGGGCAGTCATGAGTACATCCAATACTGCCGCAAGTTTGACATTGACATTCGGCTACAG
CTGATGGAGCAGAAGGTTGTGCGCAGTGACCTGGCCCGGACGGTGAATGATGACCAGAGC
CCCTCCACCTTGAACTACCTCGTCCATCTCCAAGAGAGGCCTGTCAAGCAGACCATCAGC
AGGCAGGCCCTGAGTCTTCTGTTCGACACTTACCACAATGAGGTGGATGCCTTCCTGCTG
GCTGATGGAGACTTCCCACTGAAGGCTGACAGGGTGGTCCAGTCCGTCAAGGCCATCTGC
AACGCCCTGGCCGCCGTGGAAACCCCTGAGATCACCAGTGCTCTCAACCAGCTGCCCCCC
TGCCCCTCCCGCATGCAGCCTAAAATTCAGAAGGATCCCAGTGTCTTGGCTGTGAGGGAA
AACCGAGAGAAGGTCGTGGAAGCCCTGACCGCTGCCATCTTGGACCTGGTGGAGCTGTAC
TGCAACACATTCAACGCAGACTTCCAGACGGCAGTGCCCGGGAGCCGCAAGCATGACCTG
GTCCAGGAGGCCTGCCATTTCGCCAGGTCCCTGGCCTTCACTGTCTATGCCACCCACCGC
ATCCCCATCATCTGGGCTACCAGCTATGAAGATTTCTACCTCTCCTGCTCCCTCAGCCAT
GGCGGCAAGGACATGTGCAGCCCCCTGCAGACCCGAAGAGCTCACTTCTCCAAGTACCTC
TTCCACCTCATCGTCTGGGACCAGCAGATCTGCTTCCCAGTGCAGGTGAACCGGCTGCCT
CGGGAGACACTGCTGTGTGCCACTCTCTATGCTCTGCCCATCCCCCCACCGGGGAGCTCC
TCAGAGGCCAATAAGCAGCGGCGGGTGCCTGAAGCCCTGGGCTGGGTCACTACCCCACTC
TTCAACTTCAGGCAGGTCCTGACCTGTGGCCGGAAGCTTCTGGGTTTGTGGCCAGCAACA
CAGGAAAATCCCAGCGCCCGTTGGAGTGCACCTAATTTCCACCAGCCAGACAGTGTCATC
CTGCAGATTGACTTCCCCACCTCGGCCTTTGACATCAAGTTCACCAGCCCCCCTGGAGAC
AAGTTCAGCCCCCGCTATGAGTTTGGCAGCCTCCGGGAAGAAGACCAGCGCAAGCTTAAA
GACATCATGCAGAAAGAGTCCTTGTACTGGCTCACTGATGCTGACAAGAAGCGCCTGTGG
GAGAAGCGATATTACTGCCACTCGGAGGTGAGCTCGCTCCCCCTGGTGCTCGCCAGCGCC
CCCAGCTGGGAGTGGGCTTGCCTGCCTGACATCTATGTTCTCCTGAAGCAGTGGACCCAC
ATGAACCACCAGGATGCCCTGGGGCTCCTGCATGCCACCTTCCCGGACCAGGAGGTGCGT
CGTATGGCTGTGCAGTGGATTGGCTCACTCTCAGATGCTGAGCTGCTAGACTACCTGCCC
CAGCTGGTACAGGCCCTGAAGTATGAATGCTACCTGGACAGCCCGTTGGTGCGCTTCCTC
CTGAAACGAGCTGTGTCTGACTTGAGAGTGACTCACTACTTCTTCTGGTTACTGAAGGAC
GGCCTCAAGGACTCTCAGTTCAGCATCCGCTACCAGTATCTGCTGGCAGCCTTACTGTGC
TGCTGTGGCAAGGGGCTGAGAGAAGAGTTTAACCGCCAGTGCTGGCTTGTCAATGCCCTG
GCCAAACTGGCCCAGCAGGTCCGGGAGGCAGCCCCATCTGCAAGGCAGGGAATCCTCCGC
ACGGGCCTGGAGGAGGTGAAGCAGTTCTTTGCCCTCAATGGCTCGTGCCGCTTGCCACTC
AGCCCCAGTCTGCTGGTTAAGGGAATTGTGCCCAGGGACTGTTCCTACTTCAACTCCAAT
GCTGTCCCCCTCAAACTCTCCTTCCAAAATGTGGATCCCCTGGGTGAGAACATCCGTGTC
ATCTTCAAGTGTGGGGACGACCTTCGCCAGGACATGCTAACGCTGCAGATGATTCGCATC
ATGAGCAAGATCTGGGTCCAGGAGGGGCTGGACATGCGCATGGTCATCTTCCGCTGCTTC
TCCACCGGCCGGGGCAGAGGGATGGTGGAGATGATCCCTAATGCTGAGACCCTGCGTAAG
ATCCAGGTGGAGCATGGGGTGACCGGCTCGTTCAAGGACCGGCCCCTGGCAGACTGGCTG
CAGAAACACAACCCTGGGGAGGACGAGTATGAGAAGGCTGTGGAGAACTTTATCTACTCC
TGCGCTGGCTGCTGCGTGGCCACGTACGTCTTGGGCATCTGTGACCGACATAATGACAAC
ATCATGCTGAAGACCACTGGTCACATGTTCCACATTGATTTTGGCCGCTTCCTGGGCCAT
GCCCAGATGTTTGGCAACATCAAGCGGGACCGTGCCCCCTTTGTCTTCACCTCGGACATG
GCGTATGTCATCAACGGGGGTGACAAGCCTTCCAGCCGCTTCCATGATTTTGTTGACCTT
TGCTGCCAAGCCTACAACCTCATTCGCAAGCACACCCACCTCTTCCTCAACCTTCTGGGC
CTGATGTTGTCCTGTGGGATCCCTGAACTCTCAGACCTGGAGGACCTCAAGTATGTGTAC
GATGCCCTGAGGCCTCAGGATACAGAGGCCAATGCCACTACCTACTTCACTAGGTTGATT
GAGTCCAGCCTGGGCAGTGTAGCCACAAAGCTCAATTTTTTCATCCATAATCTGGCTCAG
ATGAAGTTCACGGGCTCAGATGACCGGCTGACCCTCTCCTTTGCCTCCCGAACACACACT
CTCAAGAGCTCTGGCCGAATCAGTGATGTTTTCCTCTGCCGCCATGAGAAGATCTTCCAC
CCCAACAAAGGCTATATATATGTGGTAAAGGTGATGCGAGAGAACACTCACGAGGCCACC
TACATCCAGCGGACCTTTGAGGAGTTCCAGGAATTACACAATAAGTTGCGGCTGCTCTTC
CCTTCTTCCCACTTGCCCAGCTTCCCTAGTCGCTTCGTGATCGGCCGCTCCCGGGGAGAG
GCGGTGGCCGAGCGGCGGAGGGAGGAGCTAAACGGTTACATCTGGCACTTGATCCACGCA
CCCCCTGAGGTGGCCGAGTGTGATTTGGTGTACACCTTCTTCCACCCACTGCCCCGGGAT
GAGAAGGCTATGGGCACCAGCCCAGCTCCTAAGTCCTCAGATGGCACATGGGCCCGGCCC
GTCGGAAAGGTGGGAGGGGAGGTGAAGCTGTCCATCTCCTACAAAAACAATAAACTCTTC
ATCATGGTGATGCATATTCGGGGCTTGCAACTGCTCCAGGATGGAAATGACCCTGACCCC
TATGTGAAAATTTACCTCCTTCCTGACCCTCAGAAAACCACTAAGAGGAAAACCAAAGTG
GCCCGGAAAACCTGCAATCCTACCTACAATGAGATGTTGGTATATGATGGGATCCCCAAG
GGTGACCTGCAGCAGCGGGAGCTCCAGCTGAGCGTGCTGAGTGAGCAGGGATTCTGGGAG
AACGTCCTCCTCGGTGAGGTGAACATCCGCCTGCGAGAGCTGGACCTGGCTCAGGAGAAG
ACCGGCTGGTTCGCCCTGGGATCTCGAAGTCATGGCACCTTGTGA
Protein Properties
Number of Residues 1634
Molecular Weight 184766.1
Theoretical pI 7.3
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit beta
MSSTQGNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRAKQNADPSLISW
DEPGVDFYSKPAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNHSTSQGPQPGSDPWPK
GSLSGDYLYIFDGSDGGVSSSPGPGDIEGSCKKLSPPPLPPRASIWDTPPLPPRKGSPSS
SKISQPSDINTFSLVEQLPGKLLEHRILEEEEVLGGGGQGRLLGSVDYDGINDAITRLNL
KSTYDAEMLRDATRGWKEGRGPLDFSKDTSGKPVARSKTMPPQVPPRTYASRYGNRKNAT
PGKNRRISAAPVGSRPHTVANGHELFEVSEERDEEVAAFCHMLDILRSGSDIQDYFLTGY
VWSAVTPSPEHLGDEVNLKVTVLCDRLQEALTFTCNCSSTVDLLIYQTLCYTHDDLRNVD
VGDFVLKPCGLEEFLQNKHALGSHEYIQYCRKFDIDIRLQLMEQKVVRSDLARTVNDDQS
PSTLNYLVHLQERPVKQTISRQALSLLFDTYHNEVDAFLLADGDFPLKADRVVQSVKAIC
NALAAVETPEITSALNQLPPCPSRMQPKIQKDPSVLAVRENREKVVEALTAAILDLVELY
CNTFNADFQTAVPGSRKHDLVQEACHFARSLAFTVYATHRIPIIWATSYEDFYLSCSLSH
GGKELCSPLQTRRAHFSKYLFHLIVWDQQICFPVQVNRLPRETLLCATLYALPIPPPGSS
SEANKQRRVPEALGWVTTPLFNFRQVLTCGRKLLGLWPATQENPSARWSAPNFHQPDSVI
LQIDFPTSAFDIKFTSPPGDKFSPRYEFGSLREEDQRKLKDIMQKESLYWLTDADKKRLW
EKRYYCHSEVSSLPLVLASAPSWEWACLPDIYVLLKQWTHMNHQDALGLLHATFPDQEVR
RMAVQWIGSLSDAELLDYLPQLVQALKYECYLDSPLVRFLLKRAVSDLRVTHYFFWLLKD
GLKDSQFSIRYQYLLAALLCCCGKGLREEFNRQCWLVNALAKLAQQVREAAPSARQGILR
TGLEEVKQFFALNGSCRLPLSPSLLVKGIVPRDCSYFNSNAVPLKLSFQNVDPLGENIRV
IFKCGDDLRQDMLTLQMIRIMSKIWVQEGLDMRMVIFRCFSTGRGRGMVEMIPNAETLRK
IQVEHGVTGSFKDRPLADWLQKHNPGEDEYEKAVENFIYSCAGCCVATYVLGICDRHNDN
IMLKTTGHMFHIDFGRFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDFVDL
CCQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDTEANATTYFTRLI
ESSLGSVATKLNFFIHNLAQMKFTGSDDRLTLSFASRTHTLKSSGRISDVFLCRHEKIFH
PNKGYIYVVKVMRENTHEATYIQRTFEEFQELHNKLRLLFPSSHLPSFPSRFVIGRSRGE
AVAERRREELNGYIWHLIHAPPEVAECDLVYTFFHPLPRDEKAMGTSPAPKSSDGTWARP
VGKVGGEVKLSISYKNNKLFIMVMHIRGLQLLQDGNDPDPYVKIYLLPDPQKTTKRKTKV
ARKTCNPTYNEMLVYDGIPKGDLQQRELQLSVLSEQGFWENVLLGEVNIRLRELDLAQEK
TGWFALGSRSHGTL
GenBank ID Protein 2076604
UniProtKB/Swiss-Prot ID O00750
UniProtKB/Swiss-Prot Entry Name P3C2B_HUMAN
PDB IDs Not Available
GenBank Gene ID Y11312
GeneCard ID PIK3C2B
GenAtlas ID PIK3C2B
HGNC ID HGNC:8972
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Brown RA, Ho LK, Weber-Hall SJ, Shipley JM, Fry MJ: Identification and cDNA cloning of a novel mammalian C2 domain-containing phosphoinositide 3-kinase, HsC2-PI3K. Biochem Biophys Res Commun. 1997 Apr 17;233(2):537-44. [PubMed:9144573 ]
  4. Arcaro A, Volinia S, Zvelebil MJ, Stein R, Watton SJ, Layton MJ, Gout I, Ahmadi K, Downward J, Waterfield MD: Human phosphoinositide 3-kinase C2beta, the role of calcium and the C2 domain in enzyme activity. J Biol Chem. 1998 Dec 4;273(49):33082-90. [PubMed:9830063 ]
  5. Arcaro A, Zvelebil MJ, Wallasch C, Ullrich A, Waterfield MD, Domin J: Class II phosphoinositide 3-kinases are downstream targets of activated polypeptide growth factor receptors. Mol Cell Biol. 2000 Jun;20(11):3817-30. [PubMed:10805725 ]
  6. Wheeler M, Domin J: Recruitment of the class II phosphoinositide 3-kinase C2beta to the epidermal growth factor receptor: role of Grb2. Mol Cell Biol. 2001 Oct;21(19):6660-7. [PubMed:11533253 ]
  7. El Sheikh SS, Domin J, Tomtitchong P, Abel P, Stamp G, Lalani EN: Topographical expression of class IA and class II phosphoinositide 3-kinase enzymes in normal human tissues is consistent with a role in differentiation. BMC Clin Pathol. 2003 Oct 16;3(1):4. [PubMed:14563213 ]