Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01253
Secondary Accession Numbers
  • 6549
Name Serine/threonine-protein kinase PAK 6
Synonyms
  1. PAK-5
  2. PAK-6
  3. p21-activated kinase 6
Gene Name PAK6
Protein Type Unknown
Biological Properties
General Function Involved in protein kinase activity
Specific Function The activated kinase acts on a variety of targets
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 15q14
SNPs PAK6
Gene Sequence
>2046 bp
ATGTTCCGCAAGAAAAAGAAGAAACGCCCTGAGATCTCAGCGCCACAGAACTTCCAGCAC
CGTGTCCACACCTCCTTCGACCCCAAAGAAGGCAAGTTTGTGGGCCTCCCCCCACAATGG
CAGAACATCCTGGACACACTGCGGCGCCCCAAGCCCGTGGTGGACCCTTCGCGAATCACA
CGGGTGCAGCTCCAGCCCATGAAGACAGTGGTGCGGGGCAGCGCGATGCCTGTGGATGGC
TACATCTCGGGGCTGCTCAACGACATCCAGAAGTTGTCAGTCATCAGCTCCAACACCCTG
CGTGGTCGCAGCCCCACCAGCCGGCGGCGGGCACAGTCCCTGGGGCTGCTGGGGGATGAG
CACTGGGCCACCGACCCAGACATGTACCTCCAGAGCCCCCAGTCTGAGCGCACTGACCCC
CACGGCCTCTACCTCAGCTGCAACGGGGGCACACCAGCAGGCCACAAGCAGATGCCGTGG
CCCGAGCCACAGAGCCCACGGGTCCTGCCCAATGGGCTGGCTGCAAAGGCACAGTCCCTG
GGCCCCGCCGAGTTTCAGGGTGCCTCGCAGCGCTGTCTGCAGCTGGGTGCCTGCCTGCAG
AGCTCCCCACCAGGAGCCTCGCCCCCCACGGGCACCAATAGGCATGGAATGAAGGCTGCC
AAGCATGGCTCTGAGGAGGCCCGGCCACAGTCCTGCCTGGTGGGCTCAGCCACAGGCAGG
CCAGGTGGGGAAGGCAGCCCTAGCCCTAAGACCCGGGAGAGCAGCCTGAAGCGCAGGCTA
TTCCGAAGCATGTTCCTGTCCACTGCTGCCACAGCCCCTCCAAGCAGCAGCAAGCCAGGC
CCTCCACCACAGAGCAAGCCCAACTCCTCTTTCCGACCGCCGCAGAAAGACAACCCCCCA
AGCCTGGTGGCCAAGGCCCAGTCCTTGCCCTCGGACCAGCCGGTGGGGACCTTCAGCCCT
CTGACCACTTCGGATACCAGCAGCCCCCAGAAGTCCCTCCGCACAGCCCCGGCCACAGGC
CAGCTTCCAGGCCGGTCTTCCCCAGCGGGATCCCCCCGCACCTGGCACGCCCAGATCAGC
ACCAGCAACCTGTACCTGCCCCAGGACCCCACGGTTGCCAAGGGTGCCCTGGCTGGTGAG
GACACAGGTGTTGTGACACATGAGCAGTTCAAGGCTGCGCTCAGGATGGTGGTGGACCAG
GGTGACCCCCGGCTGCTGCTGGACAGCTACGTGAAGATTGGCGAGGGCTCCACCGGCATC
GTCTGCTTGGCCCGGGAGAAGCACTCGGGCCGCCAGGTGGCCGTCAAGATGATGGACCTC
AGGAAGCAGCAGCGCAGGGAGCTGCTCTTCAACGAGGTGGTGATCATGCGGGACTACCAG
CACTTCAACGTGGTGGAGATGTACAAGAGCTACCTGGTGGGAGAGGAGCTGTGGGTGCTC
ATGGAGTTCCTGCAGGGAGGAGCCCTCACAGACATCGTCTCCCAAGTCAGGCTGAATGAG
GAGCAGATTGCCACTGTGTGTGAGGCTGTGCTGCAGGCCCTGGCCTACCTGCATGCTCAG
GGTGTCATCCACCGGGACATCAAGAGTGACTCCATCCTGCTGACCCTCGATGGCAGGGTG
AAGCTCTCGGACTTCGGATTCTGTGCTCAGATCAGCAAAGACGTCCCTAAGAGGAAGTCC
CTGGTGGGAACCCCCTACTGGATGGCTCCTGAAGTGATCTCCAGGTCTTTGTATGCCACT
GAGGTGGATATCTGGTCTCTGGGCATCATGGTGATTGAGATGGTAGATGGGGAGCCACCG
TACTTCAGTGACTCCCCAGTGCAAGCCATGAAGAGGCTCCGGGACAGCCCCCCACCCAAG
CTGAAAAACTCTCACAAGGTCTCCCCAGTGCTGCGAGACTTCCTGGAGCGGATGCTGGTG
CGGGACCCCCAAGAGAGAGCCACAGCCCAGGAGCTCCTAGACCACCCCTTCCTGCTGCAG
ACAGGGCTACCTGAGTGCCTGGTGCCCCTGATCCAGCTCTACCGAAAGCAGACCTCCACC
TGCTGA
Protein Properties
Number of Residues 681
Molecular Weight 74868.1
Theoretical pI 10.06
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase PAK 6
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGSAMPVDGYISGLLNDIQKLSVISSNTLRGRSPTSRRRAQSLGLLGDE
HWATDPDMYLQSPQSERTDPHGLYLSCNGGTPAGHKQMPWPEPQSPRVLPNGLAAKAQSL
GPAEFQGASQRCLQLGACLQSSPPGASPPTGTNRHGMKAAKHGSEEARPQSCLVGSATGR
PGGEGSPSPKTRESSLKRRLFRSMFLSTAATAPPSSSKPGPPPQSKPNSSFRPPQKDNPP
SLVAKAQSLPSDQPVGTFSPLTTSDTSSPQKSLRTAPATGQLPGRSSPAGSPRTWHAQIS
TSNLYLPQDPTVAKGALAGEDTGVVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGI
VCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHFNVVEMYKSYLVGEELWVL
MEFLQGGALTDIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRV
KLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPP
YFSDSPVQAMKRLRDSPPPKLKNSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFLLQ
TGLPECLVPLIQLYRKQTSTC
GenBank ID Protein 9082306
UniProtKB/Swiss-Prot ID Q9NQU5
UniProtKB/Swiss-Prot Entry Name PAK6_HUMAN
PDB IDs Not Available
GenBank Gene ID AF276893
GeneCard ID PAK6
GenAtlas ID PAK6
HGNC ID HGNC:16061
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  5. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  6. Yang F, Li X, Sharma M, Zarnegar M, Lim B, Sun Z: Androgen receptor specifically interacts with a novel p21-activated kinase, PAK6. J Biol Chem. 2001 May 4;276(18):15345-53. Epub 2001 Jan 25. [PubMed:11278661 ]