You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01257
Secondary Accession Numbers
  • 6553
  • HMDBP04018
Name V-type proton ATPase subunit C 1
Synonyms
  1. V-ATPase subunit C 1
  2. Vacuolar proton pump subunit C 1
Gene Name ATP6V1C1
Protein Type Enzyme
Biological Properties
General Function Involved in hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
Specific Function Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells
Pathways Not Available
Reactions Not Available
GO Classification
Component
proton-transporting two-sector atpase complex, catalytic domain
proton-transporting v-type atpase, v1 domain
macromolecular complex
protein complex
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
hydrolase activity, acting on acid anhydrides
Process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
atp synthesis coupled proton transport
atp biosynthetic process
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:8
Locus 8q22.3
SNPs ATP6V1C1
Gene Sequence
>1149 bp
ATGACTGAGTTCTGGCTTATATCTGCTCCTGGGGAGAAAACCTGTCAGCAAACATGGGAG
AAATTGCATGCGGCAACTTCAAAGAACAATAATCTTGCTGTCACTTCCAAGTTCAATATT
CCTGACTTAAAGGTTGGCACGTTGGATGTCTTGGTTGGCTTGTCAGATGAACTGGCTAAA
CTGGATGCATTTGTAGAAGGAGTGGTTAAGAAAGTAGCTCAATACATGGCTGATGTATTG
GAAGATAGCAAAGACAAAGTTCAAGAGAATCTGTTGGCTAATGGAGTGGACTTGGTTACT
TATATAACAAGGTTCCAGTGGGACATGGCCAAATATCCAATCAAGCAGTCCCTGAAAAAT
ATTTCTGAAATAATTGCCAAGGGAGTAACTCAGATTGATAATGACCTGAAATCTCGAGCA
TCTGCATACAATAACCTGAAAGGAAATCTTCAGAATTTGGAACGAAAGAATGCAGGAAGT
TTGCTAACTAGAAGTCTAGCAGAAATTGTGAAGAAGGATGACTTTGTTCTTGATTCAGAG
TATCTCGTCACATTACTGGTAGTAGTTCCCAAGTTAAACCACAACGACTGGATTAAGCAG
TATGAAACACTAGCCGAAATGGTAGTTCCAAGGTCTAGCAATGTTCTTTCAGAGGACCAA
GACAGTTACCTGTGTAATGTCACCTTGTTTAGGAAGGCAGTTGATGACTTCAGACACAAA
GCCAGAGAAAACAAATTCATTGTTCGTGACTTCCAGTATAATGAAGAGGAGATGAAAGCA
GATAAAGAAGAAATGAACAGGCTTTCTACTGATAAGAAAAAACAATTTGGACCACTTGTA
CGGTGGCTGAAAGTGAATTTTAGTGAAGCATTTATTGCATGGATTCACGTGAAAGCATTA
CGGGTTTTCGTTGAGTCTGTTTTAAGGTATGGCTTGCCAGTGAACTTCCAAGCAATGCTA
CTTCAGCCCAATAAGAAAACTTTGAAGAAACTGAGAGAAGTATTACATGAATTGTATAAA
CATCTAGACAGCAGTGCAGCAGCTATTATTGATGCTCCTATGGATATTCCAGGTTTAAAC
CTGAGTCAACAAGAATACTACCCCTATGTGTACTACAAGATTGATTGCAACTTGCTGGAA
TTCAAGTGA
Protein Properties
Number of Residues 382
Molecular Weight 43941.2
Theoretical pI 7.58
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>V-type proton ATPase subunit C 1
MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAK
LDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKN
ISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSE
YLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHK
ARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKAL
RVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLN
LSQQEYYPYVYYKIDCNLLEFK
GenBank ID Protein 37643
UniProtKB/Swiss-Prot ID P21283
UniProtKB/Swiss-Prot Entry Name VATC1_HUMAN
PDB IDs Not Available
GenBank Gene ID X69151
GeneCard ID ATP6V1C1
GenAtlas ID ATP6V1C1
HGNC ID HGNC:856
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Smith AN, Borthwick KJ, Karet FE: Molecular cloning and characterization of novel tissue-specific isoforms of the human vacuolar H(+)-ATPase C, G and d subunits, and their evaluation in autosomal recessive distal renal tubular acidosis. Gene. 2002 Sep 4;297(1-2):169-77. [PubMed:12384298 ]
  3. van Hille B, Vanek M, Richener H, Green JR, Bilbe G: Cloning and tissue distribution of subunits C, D, and E of the human vacuolar H(+)-ATPase. Biochem Biophys Res Commun. 1993 Nov 30;197(1):15-21. [PubMed:8250920 ]
  4. Tanner SM, Austin JL, Leone G, Rush LJ, Plass C, Heinonen K, Mrozek K, Sill H, Knuutila S, Kolitz JE, Archer KJ, Caligiuri MA, Bloomfield CD, de La Chapelle A: BAALC, the human member of a novel mammalian neuroectoderm gene lineage, is implicated in hematopoiesis and acute leukemia. Proc Natl Acad Sci U S A. 2001 Nov 20;98(24):13901-6. Epub 2001 Nov 13. [PubMed:11707601 ]
  5. Nelson H, Mandiyan S, Noumi T, Moriyama Y, Miedel MC, Nelson N: Molecular cloning of cDNA encoding the C subunit of H(+)-ATPase from bovine chromaffin granules. J Biol Chem. 1990 Nov 25;265(33):20390-3. [PubMed:2147024 ]