Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01259
Secondary Accession Numbers
  • 6555
Name Death-associated protein kinase 1
Synonyms
  1. DAP kinase 1
Gene Name DAPK1
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Calcium/calmodulin-dependent serine/threonine kinase which acts as a positive regulator of apoptosis
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
biological regulation
regulation of biological process
cellular metabolic process
regulation of cellular process
signal transduction
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:9
Locus 9q34.1
SNPs DAPK1
Gene Sequence
>4293 bp
ATGACCGTGTTCAGGCAGGAAAACGTGGATGATTACTACGACACCGGCGAGGAACTTGGC
AGTGGACAGTTTGCGGTTGTGAAGAAATGCCGTGAGAAAAGCACCGGCCTCCAGTATGCC
GCCAAATTCATCAAGAAAAGGAGGACTAAGTCCAGCCGGCGGGGTGTGAGCCGCGAGGAC
ATCGAGCGGGAGGTCAGCATCCTGAAGGAGATCCAGCACCCCAATGTCATCACCCTGCAC
GAGGTCTATGAGAACAAGACGGACGTCATCCTGATCTTGGAACTCGTTGCAGGTGGCGAG
CTGTTTGACTTCTTAGCTGAAAAGGAATCTTTAACTGAAGAGGAAGCAACTGAATTTCTC
AAACAAATTCTTAATGGTGTTTACTACCTGCACTCCCTTCAAATCGCCCACTTTGATCTT
AAGCCTGAGAACATAATGCTTTTGGATAGAAATGTCCCCAAACCTCGGATCAAGATCATT
GACTTTGGGTTGGCCCATAAAATTGACTTTGGAAATGAATTTAAAAACATATTTGGGACT
CCAGAGTTTGTCGCTCCTGAGATAGTCAACTATGAACCTCTTGGTCTTGAGGCAGATATG
TGGAGTATCGGGGTAATAACCTATATCCTCCTAAGTGGGGCCTCCCCATTTCTTGGAGAC
ACTAAGCAAGAAACGTTAGCAAATGTATCCGCTGTCAACTACGAATTTGAGGATGAATAC
TTCAGTAATACCAGTGCCCTAGCCAAAGATTTCATAAGAAGACTTCTGGTCAAGGATCCA
AAGAAGAGAATGACAATTCAAGATAGTTTGCAGCATCCCTGGATCAAGCCTAAAGATACA
CAACAGGCACTTAGTAGAAAAGCATCAGCAGTAAACATGGAGAAATTCAAGAAGTTTGCA
GCCCGGAAAAAATGGAAACAATCCGTTCGCTTGATATCACTGTGCCAAAGATTATCCAGG
TCATTCCTGTCCAGAAGTAACATGAGTGTTGCCAGAAGCGATGATACTCTGGATGAGGAA
GACTCCTTTGTGATGAAAGCCATCATCCATGCCATCAACGATGACAATGTCCCAGGCCTG
CAGCACCTTCTGGGCTCATTATCCAACTATGATGTTAACCAACCCAACAAGCACGGGACA
CCTCCATTACTCATTGCTGCTGGCTGTGGGAATATTCAAATACTACAGTTGCTCATTAAA
AGAGGCTCGAGAATCGATGTCCAGGATAAGGGCGGGTCCAATGCCGTCTACTGGGCTGCT
CGGCATGGCCACGTCGATACCTTGAAATTTCTCAGTGAGAACAAATGCCCTTTGGATGTG
AAAGACAAGTCTGGAGAGATGGCCCTCCACGTGGCAGCTCGCTATGGCCATGCTGACGTG
GCTCAGTTACTGTGCAGCTTCGGCTCAAATCCCAATATCCAGGACAAGGAAGAAGAAACC
CCCCTGCACTGTGCTGCTTGGCACGGCTATTACTCTGTGGCCAAAGCCCTTTGTGAAGCC
GGCTGTAACGTGAACATCAAGAACCGAGAAGGAGAGACGCCCCTCCTGACAGCCTCTGCC
AGGGGCTACCACGACATCGTGGAGTGTCTGGCCGAACATGGAGCCGACCTTAATGCTTGC
GACAAGGACGGACACATTGCCCTTCATCTGGCTGTAAGACGGTGTCAGATGGAGGTAATC
AAGACTCTCCTCAGCCAAGGGTGTTTCGTCGATTATCAAGACAGGCACGGCAATACTCCC
CTCCATGTGGCATGTAAAGATGGCAACATGCCTATCGTGGTGGCCCTCTGTGAAGCAAAC
TGCAATTTGGACATCTCCAACAAGTATGGGCGAACGCCTCTGCACCTTGCGGCCAACAAC
GGAATCCTAGACGTGGTCCGGTATCTCTGTCTGATGGGAGCCAGCGTTGAGGCGCTGACC
ACGGACGGAAAGACGGCAGAAGATCTTGCTAGATCGGAACAGCACGAGCACGTAGCAGGT
CTCCTTGCAAGACTTCGAAAGGATACGCACCGAGGACTCTTCATCCAGCAGCTCCGACCC
ACACAGAACCTGCAGCCAAGAATTAAGCTCAAGCTGTTTGGCCACTCGGGATCCGGGAAA
ACCACCCTTGTAGAATCTCTCAAGTGTGGGCTGCTGAGGAGCTTTTTCAGAAGGCGTCGG
CCCAGACTGTCTTCCACCAACTCCAGCAGGTTCCCACCTTCACCCCTGGCTTCTAAGCCC
ACAGTCTCAGTGAGCATCAACAACCTGTACCCAGGCTGCGAGAACGTGAGTGTGAGGAGC
CGCAGCATGATGTTCGAGCCGGGTCTTACCAAAGGGATGCTGGAGGTGTTTGTGGCCCCG
ACCCACCACCCGCACTGCTCGGCCGATGACCAGTCCACCAAGGCCATCGACATCCAGAAC
GCTTATTTGAATGGAGTTGGCGATTTCAGCGTGTGGGAGTTCTCTGGAAATCCTGTGTAT
TTCTGCTGTTATGACTATTTTGCTGCAAATGATCCCACGTCAATCCATGTTGTTGTCTTT
AGTCTAGAAGAGCCCTATGAGATCCAGCTGAACCAAGTGATTTTCTGGCTCAGTTTCCTG
AAGTCCCTTGTCCCAGTTGAAGAACCCATAGCCTTCGGTGGCAAGCTGAAGAACCCACTC
CAAGTTGTCCTGGTGGCCACCCACGCTGACATCATGAATGTTCCTCGACCGGCTGGAGGC
GAGTTTGGATATGACAAAGACACATCGTTGCTGAAAGAGATTAGGAACAGGTTTGGAAAT
GATCTTCACATTTCAAATAAGCTGTTTGTTCTGGATGCTGGGGCTTCTGGGTCAAAGGAC
ATGAAGGTACTTCGAAATCATCTGCAAGAAATACGAAGCCAGATTGTTTCGGTCTGTCCT
CCCATGACTCACCTGTGTGAGAAAATCATCTCCACGCTGCCTTCCTGGAGGAAGCTCAAT
GGACCCAACCAGCTGATGTCGCTGCAGCAGTTTGTGTACGACGTGCAGGACCAGCTGAAC
CCCCTGGCCAGCGAGGAGGACCTCAGGCGCATTGCTCAGCAGCTCCACAGCACAGGCGAG
ATCAACATCATGCAAAGTGAAACAGTTCAGGACGTGCTGCTCCTGGACCCCCGCTGGCTC
TGCACAAACGTCCTGGGGAAGTTGCTGTCCGTGGAGACCCCACGGGCGCTGCACCACTAC
CGGGGCCGCTACACCGTGGAGGACATCCAGCGCCTGGTGCCCGACAGCGACGTGGAGGAG
CTGCTGCAGATCCTCGATGCCATGGACATCTGCGCCCGGGACCTGAGCAGCGGGACCATG
GTGGACGTCCCAGCCCTGATCAAGACAGACAACCTGCACCGCTCCTGGGCTGATGAGGAG
GACGAGGTGATGGTGTATGGTGGCGTGCGCATCGTGCCCGTGGAACACCTCACCCCCTTC
CCATGTGGCATCTTTCACAAGGTCCAGGTGAACCTGTGCCGGTGGATCCACCAGCAAAGC
ACAGAGGGCGACGCGGACATCCGCCTGTGGGTGAATGGCTGCAAGCTGGCCAACCGTGGG
GCCGAGCTGCTGGTGCTGCTGGTCAACCACGGCCAGGGCATTGAGGTCCAGGTCCGCGGC
CTGGAGACGGAGAAGATCAAGTGCTGCCTGCTGCTGGACTCGGTGTGCAGCACCATTGAG
AACGTCATGGCCACCACGCTGCCAGGGCTCCTGACCGTGAAGCATTACCTGAGCCCCCAG
CAGCTGCGGGAGCACCATGAGCCCGTCATGATCTACCAGCCACGGGACTTCTTCCGGGCA
CAGACTCTGAAGGAAACCTCACTGACCAACACCATGGGGGGGTACAAGGAAAGCTTCAGC
AGCATCATGTGCTTCGGGTGTCACGACGTCTACTCACAGGCCAGCCTCGGCATGGACATC
CATGCATCAGACCTGAACCTCCTCACTCGGAGGAAACTGAGTCGCCTGCTGGACCCGCCC
GACCCCCTGGGGAAGGACTGGTGCCTTCTCGCCATGAACTTAGGCCTCCCTGACCTCGTG
GCAAAGTACAACACCAGTAACGGGGCTCCCAAGGATTTCCTCCCCAGCCCCCTCCACGCC
CTGCTGCGGGAATGGACCACCTACCCTGAGAGCACAGTGGGCACCCTCATGTCCAAACTG
AGGGAGCTGGGTCGCCGGGATGCCGCAGACTTTTTGCTGAAGGCATCCTCTGTGTTCAAA
ATCAACCTGGATGGCAATGGCCAGGAGGCCTATGCCTCGAGCTGCAACAGCGGCACCTCT
TACAATTCCATTAGCTCTGTTGTATCCCGGTGA
Protein Properties
Number of Residues 1430
Molecular Weight 160071.6
Theoretical pI 6.82
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Death-associated protein kinase 1
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
IEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEY
FSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLSNYDVNQPNKHGTPPLLIAAGCGNIQILQLLIKRGSRIDVQDKGGSNAVYWAA
RHGHVDTLKFLSENKCPLDVKDKSGEMALHVAARYGHADVAQLLCSFGSNPNIQDKEEET
PLHCAAWHGYYSVAKALCEAGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNAC
DKDGHIALHLAVRRCQMEVIKTLLSQGCFVDYQDRHGNTPLHVACKDGNMPIVVALCEAN
CNLDISNKYGRTPLHLAANNGILDVVRYLCLMGASVEALTTDGKTAEDLARSEQHEHVAG
LLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRR
PRLSSTNSSRFPPSPLASKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAP
THHPHCSADDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHVVVF
SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLQVVLVATHADIMNVPRPAGG
EFGYDKDTSLLKEIRNRFGNDLHISNKLFVLDAGASGSKDMKVLRNHLQEIRSQIVSVCP
PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEEDLRRIAQQLHSTGE
INIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDSDVEE
LLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEEDEVMVYGGVRIVPVEHLTPF
PCGIFHKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRA
QTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPP
DPLGKDWCLLAMNLGLPDLVAKYNTNNGAPKDFLPSPLHALLREWTTYPESTVGTLMSKL
RELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSISSVVSR
GenBank ID Protein 89363047
UniProtKB/Swiss-Prot ID P53355
UniProtKB/Swiss-Prot Entry Name DAPK1_HUMAN
PDB IDs
GenBank Gene ID NM_004938.2
GeneCard ID DAPK1
GenAtlas ID DAPK1
HGNC ID HGNC:2674
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  5. Inbal B, Shani G, Cohen O, Kissil JL, Kimchi A: Death-associated protein kinase-related protein 1, a novel serine/threonine kinase involved in apoptosis. Mol Cell Biol. 2000 Feb;20(3):1044-54. [PubMed:10629061 ]
  6. Deiss LP, Feinstein E, Berissi H, Cohen O, Kimchi A: Identification of a novel serine/threonine kinase and a novel 15-kD protein as potential mediators of the gamma interferon-induced cell death. Genes Dev. 1995 Jan 1;9(1):15-30. [PubMed:7828849 ]
  7. Shohat G, Spivak-Kroizman T, Cohen O, Bialik S, Shani G, Berrisi H, Eisenstein M, Kimchi A: The pro-apoptotic function of death-associated protein kinase is controlled by a unique inhibitory autophosphorylation-based mechanism. J Biol Chem. 2001 Dec 14;276(50):47460-7. Epub 2001 Sep 28. [PubMed:11579085 ]
  8. Lee YR, Yuan WC, Ho HC, Chen CH, Shih HM, Chen RH: The Cullin 3 substrate adaptor KLHL20 mediates DAPK ubiquitination to control interferon responses. EMBO J. 2010 May 19;29(10):1748-61. doi: 10.1038/emboj.2010.62. Epub 2010 Apr 13. [PubMed:20389280 ]
  9. Tereshko V, Teplova M, Brunzelle J, Watterson DM, Egli M: Crystal structures of the catalytic domain of human protein kinase associated with apoptosis and tumor suppression. Nat Struct Biol. 2001 Oct;8(10):899-907. [PubMed:11573098 ]
  10. Velentza AV, Wainwright MS, Zasadzki M, Mirzoeva S, Schumacher AM, Haiech J, Focia PJ, Egli M, Watterson DM: An aminopyridazine-based inhibitor of a pro-apoptotic protein kinase attenuates hypoxia-ischemia induced acute brain injury. Bioorg Med Chem Lett. 2003 Oct 20;13(20):3465-70. [PubMed:14505650 ]