You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01268
Secondary Accession Numbers
  • 6564
Name Cell division protein kinase 13
Synonyms
  1. CDC2-related protein kinase 5
  2. Cell division cycle 2-like protein kinase 5
  3. Cholinesterase-related cell division controller
Gene Name CDK13
Protein Type Enzyme
Biological Properties
General Function Involved in protein kinase activity
Specific Function May be a controller of the mitotic cell cycle. Involved in the blood cell development
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:7
Locus 7p13
SNPs CDK13
Gene Sequence
>4539 bp
ATGCCGAGCAGCTCGGACACGGCGCTGGGGGGAGGCGGGGGCCTGAGCTGGGCGGAGAAG
AAGTTGGAGGAACGCCGCAAGCGGAGGCGATTCCTGTCCCCTCAGCAGCCGCCGCTGCTG
TTGCCGCTCCTGCAGCCGCAGCTCCTGCAACCGCCGCCGCCCCCGCCGCCTCTGCTCTTC
CTGGCTGCTCCCGGCACGGCCGCCGCCGCAGCCGCCGCCGCCGCGGCCTCCTCCTCTTGC
TTCAGCCCGGGCCCCCCTCTGGAGGTCAAGCGGCTGGCGAGAGGCAAGAGGCGCGCAGGA
GGGCGGCAGAAGCGGCGTCGCGGGCCCCGCGCCGGGCAGGAGGCGGAGAAGCGTCGGGTC
TTCTCGCTGCCCCAGCCGCAGCAGGACGGCGGTGGCGGTGCTAGTAGCGGCGGGGGTGTG
ACCCCGCTGGTGGAATACGAGGATGTGAGCTCCCAGTCCGAGCAGGGGCTGCTGCTGGGG
GGGGCCAGCGCGGCAACGGCGGCGACGGCTGCCGGGGGAACGGGGGGCAGCGGCGGGAGT
CCGGCCTCCTCCTCCGGCACCCAGCGGCGCGGGGAGGGGTCGGAGCGCAGGCCCCGCCGG
GACCGCCGCAGCAGCAGTGGCCGCAGCAAGGAGCGCCACCGCGAGCACCGGCGGCGGGAT
GGGCAGCGCGGTGGCAGCGAGGCCTCCAAGTCCCGCAGCCGCCACAGCCACAGCGGCGAG
GAACGGGCCGAGGTCGCCAAGAGCGGCAGCAGCAGCAGCAGCGGCGGCCGCCGGAAAAGC
GCTTCGGCCACATCCAGCAGCAGTAGCAGCCGCAAGGACCGGGACTCGAAGGCCCACCGC
AGCCGGACTAAGTCGTCCAAGGAGCCGCCTTCGGCCTACAAGGAACCGCCCAAGGCCTAC
CGGGAGGACAAGACCGAGCCTAAGGCCTACAGGCGGCGGCGGTCCCTCAGCCCACTGGGA
GGCCGGGACGACAGCCCGGTGTCCCACAGGGCCTCTCAGAGCCTGAGGAGCCGCAAGTCC
CCCAGCCCGGCAGGAGGTGGCAGCAGCCCCTATTCTCGGCGGCTGCCGCGCTCCCCGAGC
CCCTACAGTCGCCGCCGCTCCCCCAGCTACAGCCGCCACAGCTCCTACGAGCGGGGCGGC
GACGTGTCCCCTAGTCCCTACAGCAGCAGCAGCTGGCGCCGCTCTCGCAGTCCCTACAGC
CCTGTGCTCAGACGGTCTGGAAAATCCCGAAGCAGAAGCCCGTATTCATCTAGGCATTCA
AGATCTCGTAGCAGGCACAGATTGTCTAGATCCAGAAGTCGTCATTCTAGTATTTCTCCT
AGCACACTAACTCTGAAGAGTAGCCTGGCAGCTGAATTGAACAAGAATAAAAAAGCACGA
GCAGCAGAGGCAGCAAGAGCCGCAGAAGCAGCGAAAGCTGCAGAAGCAACTAAGGCTGCT
GAGGCTGCTGCCAAGGCTGCAAAAGCTTCAAACACTTCTACACCTACCAAGGGGAACACG
GAAACTAGTGCCAGTGCATCACAAACAAACCATGTGAAGGATGTGAAGAAAATTAAAATT
GAACATGCACCTTCTCCCTCAAGTGGTGGAACTTTAAAAAATGACAAAGCAAAAACAAAG
CCACCTCTTCAGGTAACGAAGGTGGAAAATAATTTGATTGTAGATAAAGCCACCAAGAAA
GCAGTCATAGTTGGAAAGGAGAGTAAATCTGCTGCTACAAAGGAGGAATCAGTATCTCTT
AAAGAGAAAACCAAACCACTTACACCAAGCATAGGAGCCAAGGAGAAGGAGCAACATGTA
GCTTTAGTCACCTCTACATTACCACCGTTACCTTTGCCTCCCATGCTGCCTGAAGATAAA
GAAGCTGATAGCTTACGAGGAAATATTTCAGTAAAAGCAGTTAAAAAAGAAGTAGAAAAG
AAACTCCGATGTCTTCTTGCTGATTTACCGCTGCCCCCTGAGCTACCAGGAGGAGATGAT
CTTTCAAAGAGTCCAGAGGAAAAGAAAACAGCAACACAGTTACATAGTAAAAGGAGGCCT
AAAATATGTGGGCCTCGCTATGGTGAAACCAAAGAAAAAGATATTGACTGGGGAAAACGC
TGCGTGGATAAATTTGATATCATCGGAATTATTGGAGAAGGTACTTACGGACAAGTTTAC
AAAGCCAGGGATAAAGACACTGGAGAAATGGTAGCCTTAAAAAAAGTACGTCTGGATAAT
GAAAAGGAAGGCTTTCCAATTACAGCAATTCGAGAAATTAAAATTCTCCGGCAGCTTACC
CATCAGAGTATTATCAATATGAAGGAAATAGTGACTGATAAAGAAGATGCTTTGGATTTC
AAGAAGGACAAAGGTGCATTTTATCTGGTGTTTGAATATATGGACCATGATCTGATGGGA
CTACTGGAATCAGGCTTGGTTCATTTTAATGAAAATCACATAAAGTCATTTATGAGACAG
CTCATGGAGGGTCTGGATTATTGTCATAAGAAGAACTTTTTGCATAGAGATATTAAATGT
TCCAATATCCTTCTAAATAATAGAGGGCAGATAAAACTTGCAGACTTTGGACTTGCTCGA
TTGTATAGCTCAGAAGAAAGTCGGCCGTATACTAACAAGGTAATTACTTTATGGTACCGT
CCACCTGAACTGCTACTGGGAGAAGAACGATACACACCAGCCATTGATGTATGGAGCTGT
GGCTGTATCCTTGGCGAACTCTTCACTAAAAAACCTATATTTCAAGCAAATCAGGAACTT
GCACAACTAGAATTAATAAGCCGAATATGTGGGAGTCCATGTCCTGCAGTGTGGCCTGAT
GTAATCAAACTACCATATTTCAACACCATGAAACCAAAGAAGCAATATCGTCGAAAGTTA
AGAGAAGAATTTGTTTTTATTCCTGCAGCTGCGCTAGACTTATTTGATTACATGCTTGCC
TTGGATCCTAGTAAGCGCTGCACTGCTGAACAGGCTCTTCAGTGCGAGTTCCTCCGAGAT
GTGGAACCCTCAAAAATGCCTCCACCAGATCTCCCTTTATGGCAAGATTGTCATGAGTTA
TGGAGTAAAAAGCGAAGAAGACAGAAGCAGATGGGCATGACTGATGATGTTTCCACAATT
AAAGCCCCCAGGAAGGACTTGTCTCTGGGCTTGGATGACAGCAGAACCAACACACCCCAG
GGTGTGCTGCCATCTTCACAGCTGAAATCTCAGGGCAGCTCAAATGTGGCACCTGTAAAA
ACAGGCCCTGGACAGCACTTAAACCACAGTGAATTGGCAATTCTACTAAACCTACTACAA
TCTAAAACAAGTGTTAATATGGCTGATTTTGTCCAAGTGTTGAACATTAAGGTAAACTCT
GAGACTCAACAGCAGCTAAATAAAATAAACCTTCCTGCTGGAATTTTGGCAACAGGTGAA
AAACAGACAGATCCATCAACACCACAACAGGAGTCTTCGAAACCGTTGGGAGGAATTCAG
CCTTCTTCTCAGACCATCCAGCCTAAAGTGGAGACTGATGCTGCCCAGGCGGCTGTGCAG
AGTGCATTTGCAGTTCTGTTGACTCAGTTAATAAAGGCTCAGCAGTCAAAGCAGAAAGAT
GTGCTACTAGAAGAGAGGGAAAATGGATCGGGACATGAAGCGTCATTACAACTCAGGCCA
CCTCCAGAACCTAGCACTCCGGTGTCGGGACAAGATGACCTCATCCAGCATCAAGATATG
AGGATCTTGGAGCTAACGCCAGAACCAGACCGGCCTCGAATTCTGCCTCCTGACCAACGA
CCTCCCGAGCCTCCTGAACCACCACCAGTCACTGAGGAAGATCTAGATTATCGGACAGAA
AACCAGCATGTACCCACCACCAGTTCTTCATTAACTGACCCTCATGCCGGAGTGAAGGCA
GCCCTGTTACAGCTGCTTGCTCAGCATCAGCCCCAGGATGACCCCAAAAGAGAAGGTGGG
ATTGATTATCAAGCAGGAGACACTTACGTGTCCACTTCAGACTACAAGGACAACTTTGGA
TCCTCTTCTTTCTCTTCTGCTCCTTATGTTAGCAATGATGGTCTAGGAAGCAGTTCTGCT
CCACCACTAGAACGACGTAGTTTCATTGGAAATTCAGATATTCAGTCTTTGGATAACTAC
AGTACTGCTTCATCTCATTCTGGTGGTCCACCTCAGCCTTCTGCCTTTTCTGAGTCATTT
CCCAGTTCAGTAGCTGGATATGGAGACATTTACCTCAATGCTGGTCCCATGTTGTTTAGT
GGAGACAAGGACCATAGATTTGAATATAGCCATGGTCCTATTGCAGTCCTGGCAAACAGC
AGTGACCCTTCCACGGGGCCAGAGAGTACTCATCCTTTGCCAGCAAAGATGCACAACTAT
AACTATGGTGGTAACTTACAGGAAAATCCGAGTGGCCCCAGCCTCATGCATGGACAGACC
TGGACTTCTCCTGCCCAAGGACCTGGATATTCACAAGGATACAGGGGACATATTAGCACA
TCAACTGGCAGAGGCAGAGGCAGAGGGTTACCATACTGA
Protein Properties
Number of Residues 1512
Molecular Weight 164921.5
Theoretical pI 10.28
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cell division protein kinase 13
MPSSSDTALGGGGGLSWAEKKLEERRKRRRFLSPQQPPLLLPLLQPQLLQPPPPPPPLLF
LAAPGTAAAAAAAAAASSSCFSPGPPLEVKRLARGKRRAGGRQKRRRGPRAGQEAEKRRV
FSLPQPQQDGGGGASSGGGVTPLVEYEDVSSQSEQGLLLGGASAATAATAAGGTGGSGGS
PASSSGTQRRGEGSERRPRRDRRSSSGRSKERHREHRRRDGQRGGSEASKSRSRHSHSGE
ERAEVAKSGSSSSSGGRRKSASATSSSSSSRKDRDSKAHRSRTKSSKEPPSAYKEPPKAY
REDKTEPKAYRRRRSLSPLGGRDDSPVSHRASQSLRSRKSPSPAGGGSSPYSRRLPRSPS
PYSRRRSPSYSRHSSYERGGDVSPSPYSSSSWRRSRSPYSPVLRRSGKSRSRSPYSSRHS
RSRSRHRLSRSRSRHSSISPSTLTLKSSLAAELNKNKKARAAEAARAAEAAKAAEATKAA
EAAAKAAKASNTSTPTKGNTETSASASQTNHVKDVKKIKIEHAPSPSSGGTLKNDKAKTK
PPLQVTKVENNLIVDKATKKAVIVGKESKSAATKEESVSLKEKTKPLTPSIGAKEKEQHV
ALVTSTLPPLPLPPMLPEDKEADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDD
LSKSPEEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKRCVDKFDIIGIIGEGTYGQVY
KARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALDF
KKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKC
SNILLNNRGQIKLADFGLARLYSSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSC
GCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKL
REEFVFIPAAALDLFDYMLALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHEL
WSKKRRRQKQMGMTDDVSTIKAPRKDLSLGLDDSRTNTPQGVLPSSQLKSQGSSNVAPVK
TGPGQHLNHSELAILLNLLQSKTSVNMADFVQVLNIKVNSETQQQLNKINLPAGILATGE
KQTDPSTPQQESSKPLGGIQPSSQTIQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKD
VLLEERENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMRILELTPEPDRPRILPPDQR
PPEPPEPPPVTEEDLDYRTENQHVPTTSSSLTDPHAGVKAALLQLLAQHQPQDDPKREGG
IDYQAGDTYVSTSDYKDNFGSSSFSSAPYVSNDGLGSSSAPPLERRSFIGNSDIQSLDNY
STASSHSGGPPQPSAFSESFPSSVAGYGDIYLNAGPMLFSGDKDHRFEYSHGPIAVLANS
SDPSTGPESTHPLPAKMHNYNYGGNLQENPSGPSLMHGQTWTSPAQGPGYSQGYRGHIST
STGRGRGRGLPY
GenBank ID Protein 145309302
UniProtKB/Swiss-Prot ID Q14004
UniProtKB/Swiss-Prot Entry Name CDK13_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_003718.4
GeneCard ID CDK13
GenAtlas ID CDK13
HGNC ID HGNC:1733
References
General References
  1. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  6. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  7. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  9. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  10. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  11. Nagase T, Nakayama M, Nakajima D, Kikuno R, Ohara O: Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2001 Apr 27;8(2):85-95. [PubMed:11347906 ]
  12. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  13. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  14. Brill LM, Salomon AR, Ficarro SB, Mukherji M, Stettler-Gill M, Peters EC: Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry. Anal Chem. 2004 May 15;76(10):2763-72. [PubMed:15144186 ]
  15. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  16. Marques F, Moreau JL, Peaucellier G, Lozano JC, Schatt P, Picard A, Callebaut I, Perret E, Geneviere AM: A new subfamily of high molecular mass CDC2-related kinases with PITAI/VRE motifs. Biochem Biophys Res Commun. 2000 Dec 29;279(3):832-7. [PubMed:11162436 ]
  17. Lapidot-Lifson Y, Patinkin D, Prody CA, Ehrlich G, Seidman S, Ben-Aziz R, Benseler F, Eckstein F, Zakut H, Soreq H: Cloning and antisense oligodeoxynucleotide inhibition of a human homolog of cdc2 required in hematopoiesis. Proc Natl Acad Sci U S A. 1992 Jan 15;89(2):579-83. [PubMed:1731328 ]