You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01283
Secondary Accession Numbers
  • 6579
  • HMDBP09488
Name Ribosomal protein S6 kinase alpha-1
Synonyms
  1. 90 kDa ribosomal protein S6 kinase 1
  2. MAP kinase-activated protein kinase 1a
  3. MAPK-activated protein kinase 1a
  4. MAPKAP kinase 1a
  5. MAPKAPK-1a
  6. RSK-1
  7. Ribosomal S6 kinase 1
  8. S6K-alpha-1
  9. p90-RSK 1
  10. p90RSK1
  11. p90S6K
Gene Name RPS6KA1
Protein Type Unknown
Biological Properties
General Function Involved in protein serine/threonine kinase activity
Specific Function Serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of the transcription factor CREB
Pathways
  • Intracellular Signalling Through Adenosine Receptor A2a and Adenosine
  • Intracellular Signalling Through Adenosine Receptor A2b and Adenosine
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
magnesium ion binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
signaling process
signal transmission
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
signal transmission via phosphorylation event
intracellular protein kinase cascade
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 1p
SNPs RPS6KA1
Gene Sequence
>2208 bp
ATGCCGCTCGCCCAGCTCAAGGAGCCCTGGCCGCTCATGGAGCTAGTGCCGCTGGACCCG
GAGAATGGACAGACCTCAGGGGAAGAAGCTGGACTTCAGCCGTCCAAGGATGAGGGCGTC
CTCAAGGAGATCTCCATCACGCACCACGTCAAGGCTGGCTCTGAGAAGGCTGATCCATCC
CATTTCGAGCTCCTCAAGGTTCTGGGCCAGGGATCCTTTGGCAAAGTCTTCCTGGTGCGG
AAAGTCACCCGGCCTGACAGTGGGCACCTGTATGCTATGAAGGTGCTGAAGAAGGCAACG
CTGAAAGTACGTGACCGCGTCCGGACCAAGATGGAGAGAGACATCCTGGCTGATGTAAAT
CACCCATTCGTGGTGAAGCTGCACTATGCCTTCCAGACCGAGGGCAAGCTCTATCTCATT
CTGGACTTCCTGCGTGGTGGGGACCTCTTCACCCGGCTCTCAAAAGAGGTGATGTTCACG
GAGGAGGATGTGAAGTTTTACCTGGCCGAGCTGGCTCTGGGCCTGGATCACCTGCACAGC
CTGGGTATCATTTACAGAGACCTCAAGCCTGAGAACATCCTTCTGGATGAGGAGGGCCAC
ATCAAACTCACTGACTTTGGCCTGAGCAAAGAGGCCATTGACCACGAGAAGAAGGCCTAT
TCTTTCTGCGGGACAGTGGAGTACATGGCCCCTGAGGTCGTCAACCGCCAGGGCCACTCC
CATAGTGCGGACTGGTGGTCCTATGGGGTGTTGATGTTTGAGATGCTGACGGGCTCCCTG
CCCTTCCAGGGGAAGGACCGGAAGGAGACCATGACACTGATTCTGAAGGCGAAGCTAGGC
ATGCCCCAGTTTCTGAGCACTGAAGCCCAGAGCCTCTTGCGGGCCCTGTTCAAGCGGAAT
CCTGCCAACCGGCTCGGCTCCGGCCCTGATGGGGCAGAGGAAATCAAGCGGCATGTCTTC
TACTCCACCATTGACTGGAATAAGCTATACCGTCGTGAGATCACGCCACCCTTCAAGCCA
GCAGTGGCTCAGCCTGATGACACCTTCTACTTTGACACCGAGTTCACGTCCCGCACACCC
AAGGATTCCCCAGGCATCCCCCCCAGCGCTGGGGCCCATCAGCTGTTCCGGGGCTTCAGC
TTCGTGGCCACCGGCTTGATGGAAGACGACGGCAAGCCTCGTGCCCCGCAGGCACCCCTG
CACTCGGTGGTACAGCAACTCCATGGGAAGAACCTGGTTTTTAGTGACGGCTACGTGGTA
AAGGAGACAATTGGTGTGGGCTCCTACTCTGAGTGCAAGCGCTGTGTCCACAAGGCCACC
AACATGGAGTATGCTGTCAAGGTCATTGATAAGAGCAAGCGGGATCCTTCAGAAGAGATT
GAGATTCTTCTGCGGTATGGCCAGCACCCCAACATCATCACTCTGAAAGATGTGTATGAT
GATGGCAAACACGTGTACCTGGTGACAGAGCTGATGCGGGGTGGGGAGCTGCTGGACAAG
ATCCTGCGGCAGAAGTTCTTCTCAGAGCGGGAGGCCAGCTTTGTCCTGCACACCATTGGC
AAAACTGTGGAGTATCTGCACTCACAGGGGGTTGTGCACAGGGACCTGAAGCCCAGCAAC
ATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTT
GCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTT
GTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTG
GGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGAC
ACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAAT
TGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCC
CACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAG
CTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCC
ACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCC
ATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGA
Protein Properties
Number of Residues 735
Molecular Weight 82722.4
Theoretical pI 7.94
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ribosomal protein S6 kinase alpha-1
MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPS
HFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVN
HPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHS
LGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHS
HSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRN
PANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSRTP
KDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSDGYVV
KETIGVGSYSECKRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPNIITLKDVYD
DGKHVYLVTELMRGGELLDKILRQKFFSEREASFVLHTIGKTVEYLHSQGVVHRDLKPSN
ILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSL
GILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDP
HQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESS
ILAQRRVRKLPSTTL
GenBank ID Protein 292457
UniProtKB/Swiss-Prot ID Q15418
UniProtKB/Swiss-Prot Entry Name KS6A1_HUMAN
PDB IDs Not Available
GenBank Gene ID L07597
GeneCard ID RPS6KA1
GenAtlas ID RPS6KA1
HGNC ID HGNC:10430
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  6. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  7. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  8. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  9. Kim JE, Tannenbaum SR, White FM: Global phosphoproteome of HT-29 human colon adenocarcinoma cells. J Proteome Res. 2005 Jul-Aug;4(4):1339-46. [PubMed:16083285 ]
  10. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  11. Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. Mol Cell Proteomics. 2007 Mar;6(3):537-47. Epub 2006 Dec 27. [PubMed:17192257 ]
  12. Moller DE, Xia CH, Tang W, Zhu AX, Jakubowski M: Human rsk isoforms: cloning and characterization of tissue-specific expression. Am J Physiol. 1994 Feb;266(2 Pt 1):C351-9. [PubMed:8141249 ]
  13. Deak M, Clifton AD, Lucocq LM, Alessi DR: Mitogen- and stress-activated protein kinase-1 (MSK1) is directly activated by MAPK and SAPK2/p38, and may mediate activation of CREB. EMBO J. 1998 Aug 3;17(15):4426-41. [PubMed:9687510 ]
  14. Dalby KN, Morrice N, Caudwell FB, Avruch J, Cohen P: Identification of regulatory phosphorylation sites in mitogen-activated protein kinase (MAPK)-activated protein kinase-1a/p90rsk that are inducible by MAPK. J Biol Chem. 1998 Jan 16;273(3):1496-505. [PubMed:9430688 ]
  15. Roux PP, Richards SA, Blenis J: Phosphorylation of p90 ribosomal S6 kinase (RSK) regulates extracellular signal-regulated kinase docking and RSK activity. Mol Cell Biol. 2003 Jul;23(14):4796-804. [PubMed:12832467 ]