You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01286
Secondary Accession Numbers
  • 6582
Name Inositol polyphosphate multikinase
Synonyms
  1. Inositol 1,3,4,6-tetrakisphosphate 5-kinase
Gene Name IPMK
Protein Type Enzyme
Biological Properties
General Function Involved in inositol trisphosphate 3-kinase activity
Specific Function Inositol phosphate kinase with a broad substrate specificity. Has a preference for inositol 1,4,5-trisphosphate (Ins(1,4,5)P3) and inositol 1,3,4,6-tetrakisphosphate (Ins(1,3,4,6)P4).
Pathways
  • Inositol Metabolism
  • Inositol phosphate metabolism
  • Inositol Phosphate Metabolism
Reactions
Adenosine triphosphate + Inositol 1,4,5-trisphosphate → ADP + 1D-myo-inositol 1,3,4,5,6-pentakisphosphate details
Adenosine triphosphate + Inositol 1,4,5-trisphosphate → ADP + 1D-Myo-inositol 1,4,5,6-tetrakisphosphate details
Adenosine triphosphate + 1D-Myo-inositol 1,4,5,6-tetrakisphosphate → ADP + Inositol 1,3,4,5,6-pentakisphosphate details
Adenosine triphosphate + Inositol 1,4,5-trisphosphate → ADP + Inositol 1,3,4,5,6-pentakisphosphate details
GO Classification
Biological Process
neural tube formation
inositol phosphate biosynthetic process
Cellular Component
nucleus
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
inositol or phosphatidylinositol kinase activity
inositol trisphosphate kinase activity
inositol trisphosphate 3-kinase activity
Molecular Function
ATP binding
inositol-1,4,5-trisphosphate 3-kinase activity
inositol tetrakisphosphate 3-kinase activity
inositol-1,4,5-trisphosphate 6-kinase activity
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location 10
Locus 10q21.1
SNPs IPMK
Gene Sequence
>1251 bp
ATGGCAACAGAGCCACCATCCCCCCTCCGGGTCGAGGCGCCGGGCCCCCCAGAAATGCGG
ACCTCACCGGCGATCGAGTCCACCCCTGAGGGCACCCCGCAGCCGGCGGGCGGCAGACTC
CGCTTCCTCAACGGCTGCGTGCCCCTCTCGCATCAGGTGGCCGGGCACATGTACGGGAAG
GACAAAGTGGGTATACTGCAACATCCAGATGGCACAGTTTTGAAACAGTTACAACCACCT
CCAAGGGGCCCAAGAGAGCTGGAATTCTATAATATGGTTTATGCTGCTGACTGTTTTGAT
GGTGTTCTTCTAGAGCTACGAAAATATTTGCCAAAATATTATGGCATCTGGTCACCTCCC
ACTGCACCAAACGATTTATACCTAAAACTGGAAGATGTGACCCATAAATTTAATAAGCCC
TGTATAATGGATGTAAAGATAGGGCAAAAAAGCTATGATCCTTTTGCCTCATCTGAGAAG
ATTCAGCAACAGGTCAGCAAGTACCCATTAATGGAAGAGATTGGGTTCTTGGTGCTTGGC
ATGAGGGTTTATCATGTTCATTCCGATAGCTATGAGACAGAAAACCAGCATTACGGAAGA
AGCTTAACAAAAGAAACTATAAAGGATGGAGTCTCCAGATTTTTTCATAATGGGTACTGC
TTAAGAAAAGATGCTGTTGCTGCCAGTATTCAGAAGATTGAGAAAATTCTGCAGTGGTTT
GAAAACCAGAAGCAGCTTAATTTTTACGCAAGTTCATTACTCTTTGTTTATGAAGGTTCA
TCTCAGCCAACCACTACAAAATTGAATGACAGAACTTTGGCAGAAAAGTTTTTGTCCAAA
GGACAACTGTCAGACACAGAAGTACTAGAGTACAATAATAACTTTCATGTGTTAAGTTCC
ACAGCTAATGGAAAAATAGAGTCTTCAGTGGGCAAAAGCTTGTCCAAGATGTATGCGCGT
CACAGGAAAATATATACAAAAAAGCATCACAGTCAGACTTCATTGAAAGTTGAAAATCTG
GAGCAAGACAATGGGTGGAAAAGCATGTCACAGGAACATTTAAATGGAAATGTACTTTCC
CAACTGGAAAAAGTTTTCTACCATCTTCCCACTGGTTGCCAAGAGATTGCTGAAGTAGAA
GTGCGAATGATAGATTTTGCTCATGTGTTCCCTAGCAACACAATAGATGAGGGATATGTT
TATGGGCTAAAGCATTTAATTTCTGTACTTCGAAGTATTTTAGACAATTGA
Protein Properties
Number of Residues 416
Molecular Weight 47221.455
Theoretical pI 7.634
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Inositol polyphosphate multikinase
MATEPPSPLRVEAPGPPEMRTSPAIESTPEGTPQPAGGRLRFLNGCVPLSHQVAGHMYGK
DKVGILQHPDGTVLKQLQPPPRGPRELEFYNMVYAADCFDGVLLELRKYLPKYYGIWSPP
TAPNDLYLKLEDVTHKFNKPCIMDVKIGQKSYDPFASSEKIQQQVSKYPLMEEIGFLVLG
MRVYHVHSDSYETENQHYGRSLTKETIKDGVSRFFHNGYCLRKDAVAASIQKIEKILQWF
ENQKQLNFYASSLLFVYEGSSQPTTTKLNDRTLAEKFLSKGQLSDTEVLEYNNNFHVLSS
TANGKIESSVGKSLSKMYARHRKIYTKKHHSQTSLKVENLEQDNGWKSMSQEHLNGNVLS
QLEKVFYHLPTGCQEIAEVEVRMIDFAHVFPSNTIDEGYVYGLKHLISVLRSILDN
GenBank ID Protein 22532105
UniProtKB/Swiss-Prot ID Q8NFU5
UniProtKB/Swiss-Prot Entry Name IPMK_HUMAN
PDB IDs Not Available
GenBank Gene ID AF432853
GeneCard ID IPMK
GenAtlas ID IPMK
HGNC ID HGNC:20739
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Nalaskowski MM, Deschermeier C, Fanick W, Mayr GW: The human homologue of yeast ArgRIII protein is an inositol phosphate multikinase with predominantly nuclear localization. Biochem J. 2002 Sep 1;366(Pt 2):549-56. [PubMed:12027805 ]
  5. Chang SC, Miller AL, Feng Y, Wente SR, Majerus PW: The human homolog of the rat inositol phosphate multikinase is an inositol 1,3,4,6-tetrakisphosphate 5-kinase. J Biol Chem. 2002 Nov 15;277(46):43836-43. Epub 2002 Sep 9. [PubMed:12223481 ]