Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01289
Secondary Accession Numbers
  • 6585
Name Serine/threonine-protein kinase PLK4
Synonyms
  1. PLK-4
  2. Polo-like kinase 4
  3. Serine/threonine-protein kinase 18
  4. Serine/threonine-protein kinase Sak
Gene Name PLK4
Protein Type Enzyme
Biological Properties
General Function Involved in protein binding
Specific Function Serine/threonine-protein kinase that plays a central role in centriole duplication. Able to trigger procentriole formation on the surface of the parental centriole cylinder, leading to the recruitment of centriole biogenesis proteins such as SASS6, CENPJ/CPAP, CP110, CEP135 and gamma-tubulin. When overexpressed, it is able to induce centrosome amplification through the simultaneous generation of multiple procentrioles adjoining each parental centriole during S phase. Its central role in centriole replication suggests a posible role in tumorigenesis, centrosome aberrations being frequently observed in tumors. Also involved in trophoblast differentiation by phosphorylating HAND1, leading to disrupt the interaction between HAND1 and MDFIC and activate HAND1. Phosphorylates CDC25C and CHEK2/CHK2
Pathways Not Available
Reactions Not Available
GO Classification
Function
protein tyrosine kinase activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. nucleolus
  4. cytoskeleton
  5. centrosome
  6. centriole
  7. Cleavage furrow
Gene Properties
Chromosome Location Chromosome:4
Locus 4q28
SNPs PLK4
Gene Sequence
>2913 bp
ATGGCGACCTGCATCGGGGAGAAGATCGAGGATTTTAAAGTTGGAAATCTGCTTGGTAAA
GGATCATTTGCTGGTGTCTACAGAGCTGAGTCCATTCACAGTGGTTTGGAAGTTGCAATC
AAAATGATAGATAAGAAAGCCATGTACAAAGCAGGAATGGTACAGAGAGTCCAAAATGAG
GTGAAAATACATTGCCAATTGAAACATCCTTCTATCTTGGAGCTTTATAACTATTTTGAA
GATAGCAATTATGTGTATCTGGTATTAGAAATGTGCCATAATGGAGAAATGAACAGGTAT
CTAAAGAATAGAGTGAAACCCTTCTCAGAAAATGAAGCTCGACACTTCATGCACCAGATC
ATCACAGGGATGTTGTATCTTCATTCTCATGGTATACTACACCGGGACCTCACACTTTCT
AACCTCCTACTGACTCGTAATATGAACATCAAGATTGCTGATTTTGGGCTGGCAACTCAA
CTGAAAATGCCACATGAAAAGCACTATACATTATGTGGAACTCCTAACTACATTTCACCA
GAAATTGCCACTCGAAGTGCACATGGCCTTGAATCTGATGTTTGGTCCCTGGGCTGTATG
TTTTATACATTACTTATCGGGAGACCACCCTTCGACACTGACACAGTCAAGAACACATTA
AATAAAGTAGTATTGGCAGATTATGAAATGCCAACTTTTTTGTCAATAGAGGCCAAGGAC
CTTATTCACCAGTTACTTCGTAGAAATCCAGCAGATCGTTTAAGTCTGTCTTCAGTATTG
GACCATCCTTTTATGTCCCGAAATTCTTCAACAAAAAGTAAAGATTTAGGAACTGTGGAA
GACTCAATTGATAGTGGGCATGCCACAATTTCTACTGCAATTACAGCTTCTTCCAGTACC
AGTATAAGTGGTAGTTTATTTGACAAAAGAAGACTTTTGATTGGTCAGCCACTCCCAAAT
AAAATGACTGTATTTCCAAAGAATAAAAGTTCAACTGATTTTTCTTCTTCAGGAGATGGA
AACAGTTTTTATACTCAGTGGGGAAATCAAGAAACCAGTAATAGTGGAAGGGGAAGAGTA
ATTCAAGATGCAGAAGAAAGGCCACATTCTCGATACCTTCGTAGAGCTTATTCCTCTGAT
AGATCTGGCACTTCTAATAGACAGTCTCAAGCAAAAACATATACAATGGAACGATGTCAC
TCAGCAGAAATGCTTTCAGTGTCCAAAAGATCAGGAGGAGGTGAAAATGAAGAGAGGTAC
TCACCCACAGACAACAATGCCAACATTTTTAACTTCTTTAAAGAAAAGACATCCAGTAGT
TCTGGATCTTTTGAAAGACCTGATAACAATCAAGCACTCTCCAATCATCTTTGTCCAGGA
AAAACTCCTTTTCCATTTGCAGACCCGACACCTCAGACTGAAACCGTACAACAGTGGTTT
GGGAATCTGCAAATAAATGCTCATTTAAGAAAAACTACTGAATATGACAGCATCAGCCCA
AACCGGGACTTCCAGGGCCATCCAGATTTGCAGAAGGACACATCAAAAAATGCCTGGACT
GATACAAAAGTCAAAAAGAACTCTGATGCTTCTGATAATGCACATTCTGTAAAACAGCAA
AATACCATGAAATATATGACTGCACTTCACAGTAAACCTGAGATAATCCAACAAGAATGT
GTTTTTGGCTCAGATCCTCTTTCTGAACAGAGCAAGACTAGGGGTATGGAGCCACCATGG
GGTTATCAGAATCGTACATTAAGAAGCATTACATCTCCGTTGGTTGCTCACAGGTTAAAA
CCAATCAGACAGAAAACCAAAAAGGCTGTGGTGAGCATACTTGATTCAGAGGAGGTGTGT
GTGGAGCTTGTAAAGGAGTATGCATCTCAAGAATATGTGAAAGAAGTTCTTCAGATATCT
AGTGATGGAAATACGATCACTATTTATTATCCAAATGGTGGTAGAGGTTTTCCTCTTGCT
GATAGACCACCCTCACCTACTGACAACATCAGTAGGTACAGCTTTGACAATTTACCAGAA
AAATACTGGCGAAAATATCAATATGCTTCCAGGTTTGTACAGCTTCTAAGATCTAAATCT
CCCAAAATCACTTATTTTACAAGATATGCTAAATGCATTTTGATGGAGAATTCTCCTGGT
GCTGATTTTGAGGTTTGGTTTTATGATGGGGTAAAAATACACAAAACAGAAGATTTCATT
CAGGTGATTGAAAAGACAGGGAAGTCTTACACTTTAAAAAGTGAAAGTGAAGTTAATAGC
TTGAAAGAGGAGATAAAAATGTATATGGACCATGCTAATGAGGGTCATCGTATTTGTTTA
GCACTGGAATCCATAATTTCAGAAGAGGAAAGGAAAACTAGGAGTGCTCCCTTTTTCCCA
ATAATCATAGGAAGAAAACCTGGTAGTACTAGTTCACCTAAGGCCTTATCACCTCCTCCT
TCTGTGGATTCAAATTACCCAACGAGAGATAGAGCATCTTTCAACAGAATGGTCATGCAT
AGTGATGCTTCTCCAACACAGGCACCAATCCTTAATCCCTCTATGGTTACAAATGAAGGA
CTTGGTCTTACAACTACAGCTTCTGGAACAGACATCTCTTCTAATAGTCTAAAAGATTGT
CTTCCTAAATCAGCACAACTTTTGAAATCTGTTTTTGTGAAAAATGTTGGTTGGGCTACA
CAGTTAACTAGTGGAGCTGTGTGGGTTCAGTTTAATGATGGGTCCCAGTTGGTTGTGCAG
GCAGGAGTGTCTTCTATCAGTTATACCTCACCAAATGGTCAAACAACTAGGTATGGAGAA
AATGAAAAATTACCAGACTACATCAAACAGAAATTACAGTGTCTGTCTTCCATCCTTTTG
ATGTTTTCTAATCCGACTCCTAATTTTCATTGA
Protein Properties
Number of Residues 970
Molecular Weight 108971.1
Theoretical pI 8.83
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase PLK4
MATCIGEKIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNE
VKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSENEARHFMHQI
ITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLATQLKMPHEKHYTLCGTPNYISP
EIATRSAHGLESDVWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPSFLSIEAKD
LIHQLLRRNPADRLSLSSVLDHPFMSRNSSTKSKDLGTVEDSIDSGHATISTAITASSST
SISGSLFDKRRLLIGQPLPNKMTVFPKNKSSTDFSSSGDGNSFYTQWGNQETSNSGRGRV
IQDAEERPHSRYLRRAYSSDRSGTSNSQSQAKTYTMERCHSAEMLSVSKRSGGGENEERY
SPTDNNANIFNFFKEKTSSSSGSFERPDNNQALSNHLCPGKTPFPFADPTPQTETVQQWF
GNLQINAHLRKTTEYDSISPNRDFQGHPDLQKDTSKNAWTDTKVKKNSDASDNAHSVKQQ
NTMKYMTALHSKPEIIQQECVFGSDPLSEQSKTRGMEPPWGYQNRTLRSITSPLVAHRLK
PIRQKTKKAVVSILDSEEVCVELVKEYASQEYVKEVLQISSDGNTITIYYPNGGRGFPLA
DRPPSPTDNISRYSFDNLPEKYWRKYQYASRFVQLVRSKSPKITYFTRYAKCILMENSPG
ADFEVWFYDGVKIHKTEDFIQVIEKTGKSYTLKSESEVNSLKEEIKMYMDHANEGHRICL
ALESIISEEERKTRSAPFFPIIIGRKPGSTSSPKALSPPPSVDSNYPTRERASFNRMVMH
SAASPTQAPILNPSMVTNEGLGLTTTASGTDISSNSLKDCLPKSAQLLKSVFVKNVGWAT
QLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILL
MFSNPTPNFH
GenBank ID Protein 16215696
UniProtKB/Swiss-Prot ID O00444
UniProtKB/Swiss-Prot Entry Name PLK4_HUMAN
PDB IDs Not Available
GenBank Gene ID AB006972
GeneCard ID PLK4
GenAtlas ID PLK4
HGNC ID HGNC:11397
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  5. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  6. Petrinac S, Ganuelas ML, Bonni S, Nantais J, Hudson JW: Polo-like kinase 4 phosphorylates Chk2. Cell Cycle. 2009 Jan 15;8(2):327-9. [PubMed:19164942 ]
  7. Yamashita Y, Kajigaya S, Yoshida K, Ueno S, Ota J, Ohmine K, Ueda M, Miyazato A, Ohya K, Kitamura T, Ozawa K, Mano H: Sak serine-threonine kinase acts as an effector of Tec tyrosine kinase. J Biol Chem. 2001 Oct 19;276(42):39012-20. Epub 2001 Aug 6. [PubMed:11489907 ]
  8. Mills GB, Schmandt R, Gibson S, Leung B, Hill M, May C, Shi YF, Branch DR, Radvanyi L, Truitt KE, et al.: Transmembrane signaling by the interleukin-2 receptor: progress and conundrums. Semin Immunol. 1993 Oct;5(5):345-64. [PubMed:8260651 ]
  9. Lehtola L, Partanen J, Sistonen L, Korhonen J, Warri A, Harkonen P, Clarke R, Alitalo K: Analysis of tyrosine kinase mRNAs including four FGF receptor mRNAs expressed in MCF-7 breast-cancer cells. Int J Cancer. 1992 Feb 20;50(4):598-603. [PubMed:1311287 ]
  10. Bettencourt-Dias M, Rodrigues-Martins A, Carpenter L, Riparbelli M, Lehmann L, Gatt MK, Carmo N, Balloux F, Callaini G, Glover DM: SAK/PLK4 is required for centriole duplication and flagella development. Curr Biol. 2005 Dec 20;15(24):2199-207. Epub 2005 Dec 1. [PubMed:16326102 ]
  11. Habedanck R, Stierhof YD, Wilkinson CJ, Nigg EA: The Polo kinase Plk4 functions in centriole duplication. Nat Cell Biol. 2005 Nov;7(11):1140-6. [PubMed:16244668 ]
  12. Li J, Tan M, Li L, Pamarthy D, Lawrence TS, Sun Y: SAK, a new polo-like kinase, is transcriptionally repressed by p53 and induces apoptosis upon RNAi silencing. Neoplasia. 2005 Apr;7(4):312-23. [PubMed:15967108 ]
  13. Kleylein-Sohn J, Westendorf J, Le Clech M, Habedanck R, Stierhof YD, Nigg EA: Plk4-induced centriole biogenesis in human cells. Dev Cell. 2007 Aug;13(2):190-202. [PubMed:17681131 ]
  14. Bonni S, Ganuelas ML, Petrinac S, Hudson JW: Human Plk4 phosphorylates Cdc25C. Cell Cycle. 2008 Feb 15;7(4):545-7. Epub 2007 Nov 25. [PubMed:18239451 ]
  15. Kuriyama R, Bettencourt-Dias M, Hoffmann I, Arnold M, Sandvig L: Gamma-tubulin-containing abnormal centrioles are induced by insufficient Plk4 in human HCT116 colorectal cancer cells. J Cell Sci. 2009 Jun 15;122(Pt 12):2014-23. doi: 10.1242/jcs.036715. Epub 2009 May 19. [PubMed:19454482 ]