You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01300
Secondary Accession Numbers
  • 6596
Name Serine/threonine-protein kinase Nek9
Synonyms
  1. Nek8
  2. Nercc1 kinase
  3. Never in mitosis A-related kinase 9
  4. NimA-related kinase 8
  5. NimA-related protein kinase 9
Gene Name NEK9
Protein Type Unknown
Biological Properties
General Function Involved in protein kinase activity
Specific Function Pleiotropic regulator of mitotic progression, participating in the control of spindle dynamics and chromosome separation. Phosphorylates different histones, myelin basic protein, beta-casein, and BICD2. Phosphorylates histone H3 on serine and threonine residues and beta-casein on serine residues. Important for G1/S transition and S phase progression
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 14q24.3
SNPs NEK9
Gene Sequence
>2940 bp
ATGTCGGTGCTGGGCGAGTACGAGCGACACTGCGATTCCATCAACTCGGACTTTGGGAGC
GAGTCCGGGGGTTGCGGGGACTCGAGTCCGGGGCCTAGCGCCAGTCAGGGGCCGCGAGCC
GGCGGCGGCGCGGCGGAGCAGGAGGAACTGCACTACATCCCCATCCGCGTCCTGGGCCGC
GGCGCCTTCGGGGAAGCCACGCTGTACCGCCGCACCGAGGATGACTCACTGGTTGTGTGG
AAGGAAGTCGATTTGACCCGGCTGTCTGAGAAGGAACGTCGTGATGCCTTGAATGAGATT
GTTATTCTGGCACTGCTGCAGCACGACAACATTATTGCCTACTACAATCACTTCATGGAC
AATACCACGCTGCTGATTGAGCTGGAATATTGTAATGGAGGGAACCTGTATGACAAAATC
CTTCGTCAGAAGGACAAGTTGTTTGAGGAAGAGATGGTGGTGTGGTACCTATTTCAGATT
GTTTCAGCAGTGAGCTGCATCCATAAAGCTGGAATCCTTCATAGAGATATAAAGACATTA
AATATTTTTCTGACCAAGGCAAACCTGATAAAACTTGGAGATTATGGCCTAGCAAAGAAA
CTTAATTCTGAGTATTCCATGGCTGAGACGCTTGTGGGAACCCCATATTACATGTCTCCA
GAGCTCTGTCAAGGAGTAAAGTACAATTTCAAGTCTGATATCTGGGCAGTTGGCTGCGTC
ATTTTTGAACTGCTTACCTTAAAGAGGACGTTTGATGCTACAAACCCACTTAACCTGTGT
GTGAAGATCGTGCAAGGAATTCGGGCCATGGAAGTTGACTCTAGCCAGTACTCTTTGGAA
TTGATCCAAATGGTTCATTCGTGCCTTGACCAGGATCCTGAGCAGAGACCTACTGCAGAT
GAACTTCTAGATCGCCCTCTTCTCAGGAAACGCAGGAGAGAGATGGAGGAAAAAGTCACT
CTGCTTAATGCACCTACAAAGAGACCAAGGTCAAGCACTGTGACTGAAGCACCCATTGCT
GTAGTAACATCACGAACCAGTGAAGTCTATGTTTGGGGTGGTGGAAAATCCACCCCCCAG
AAACTGGATGTTATCAAGAGTGGCTGTAGTGCCCGGCAGGTCTGTGCAGGGAATACCCAC
TTTGCTGTGGTCACAGTGGAGAAGGAACTGTACACTTGGGTGAACATGCAAGGAGGCACT
AAACTCCATGGTCAGCTGGGCCATGGAGACAAAGCCTCCTATCGACAGCCAAAGCATGTG
GAAAAGTTGCAAGGCAAAGCTATCCGTCAGGTGTCATGTGGTGATGATTTCACTGTCTGT
GTGACTGATGAGGGTCAGCTCTATGCCTTCGGATCAGATTATTATGGCTGCATGGGGGTG
GACAAAGTTGCTGGCCCTGAAGTGCTAGAACCCATGCAGCTGAACTTCTTCCTCAGCAAT
CCAGTGGAGCAGGTCTCCTGTGGAGATAATCATGTGGTGGTTCTGACACGAAACAAGGAA
GTCTATTCTTGGGGCTGTGGCGAATATGGACGACTGGGTTTGGATTCAGAAGAGGATTAT
TATACACCACAAAAGGTGGATGTTCCCAAGGCCTTGATTATTGTTGCAGTTCAATGTGGC
TGTGATGGGACATTTCTGTTGACCCAGTCAGGCAAAGTGCTGGCCTGTGGACTCAATGAA
TTCAATAAGCTGGGTCTGAATCAGTGCATGTCGGGAATTATCAACCATGAAGCATACCAT
GAAGTTCCCTACACAACGTCCTTTACCTTGGCCAAACAGTTGTCCTTTTATAAGATCCGT
ACCATTGCCCCAGGCAAGACTCACACAGCTGCTATTGATGAGCGAGGCCGGCTGCTGACC
TTTGGCTGCAACAAGTGTGGGCAGCTGGGCGTTGGGAACTACAAGAAGCGTCTGGGAATC
AACCTGTTGGGGGGACCCCTTGGTGGGAAGCAAGTGATCAGGGTCTCCTGCGGTGATGAG
TTTACCATTGCTGCCACTGATGATAATCACATTTTTGCCTGGGGCAATGGTGGTAATGGC
CGCCTGGCAATGACCCCCACAGAGAGACCACATGGCTCTGATATCTGTACCTCATGGCCT
CGGCCTATTTTTGGATCTCTGCATCATGTCCCGGACCTGTCTTGCCGTGGATGGCATACC
ATTCTCATCGTTGAGAAAGTATTGAATTCTAAGACCATCCGTTCCAATAGCAGTGGCTTA
TCCATTGGAACTGTGTTTCAGAGCTCTAGCCCGGGAGGAGGCGGCGGGGGCGGCGGTGGT
GAAGAAGAGGACAGTCAGCAGGAATCTGAAACTCCTGACCCAAGTGGAGGCTTCCGAGGA
ACAATGGAAGCAGACCGAGGAATGGAAGGTTTAATCAGTCCCACAGAGGCCATGGGGAAC
AGTAATGGGGCCAGCAGCTCCTGTCCTGGCTGGCTTCGAAAGGAGCTGGAAAATGCAGAA
TTTATCCCCATGCCTGACAGCCCATCTCCTCTCAGTGCAGCGTTTTCAGAATCTGAGAAA
GATACCCTGCCCTATGAAGAGCTGCAAGGACTCAAAGTGGCCTCTGAAGCTCCTTTGGAA
CACAAACCCCAAGTAGAAGCCTCGTCACCTCGGCTGAATCCTGCAGTAACCTGTGCTGGG
AAGGGAACACCACTGACTCCTCCTGCGTGTGCGTGCAGCTCTCTGCAGGTGGAGGTTGAG
AGATTGCAGGGTCTGGTGTTAAAGTGTCTGGCTGAACAACAGAAGCTACAGCAAGAAAAC
CTCCAGATTTTTACCCAACTGCAGAAGTTGAACAAGAAATTAGAAGGAGGGCAGCAGGTG
GGGATGCATTCCAAAGGAACTCAGACAGCAAAGGAAGAGATGGAAATGGATCCAAAGCCT
GACTTAGATTCAGATTCCTGGTGCCTCCTGGGAACAGACTCCTGTAGACCCAGCCTCTAG
Protein Properties
Number of Residues 979
Molecular Weight 107167.7
Theoretical pI 5.5
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase Nek9
MSVLGEYERHCDSINSDFGSESGGCGDSSPGPSASQGPRAGGGAAEQEELHYIPIRVLGR
GAFGEATLYRRTEDDSLVVWKEVDLTRLSEKERRDALNEIVILALLQHDNIIAYYNHFMD
NTTLLIELEYCNGGNLYDKILRQKDKLFEEEMVVWYLFQIVSAVSCIHKAGILHRDIKTL
NIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQGVKYNFKSDIWAVGCV
IFELLTLKRTFDATNPLNLCVKIVQGIRAMEVDSSQYSLELIQMVHSCLDQDPEQRPTAD
ELLDRPLLRKRRREMEEKVTLLNAPTKRPRSSTVTEAPIAVVTSRTSEVYVWGGGKSTPQ
KLDVIKSGCSARQVCAGNTHFAVVTVEKELYTWVNMQGGTKLHGQLGHGDKASYRQPKHV
EKLQGKAIRQVSCGDDFTVCVTDEGQLYAFGSDYYGCMGVDKVAGPEVLEPMQLNFFLSN
PVEQVSCGDNHVVVLTRNKEVYSWGCGEYGRLGLDSEEDYYTPQKVDVPKALIIVAVQCG
CDGTFLLTQSGKVLACGLNEFNKLGLNQCMSGIINHEAYHEVPYTTSFTLAKQLSFYKIR
TIAPGKTHTAAIDERGRLLTFGCNKCGQLGVGNYKKRLGINLLGGPLGGKQVIRVSCGDE
FTIAATDDNHIFAWGNGGNGRLAMTPTERPHGSDICTSWPRPIFGSLHHVPDLSCRGWHT
ILIVEKVLNSKTIRSNSSGLSIGTVFQSSSPGGGGGGGGGEEEDSQQESETPDPSGGFRG
TMEADRGMEGLISPTEAMGNSNGASSSCPGWLRKELENAEFIPMPDSPSPLSAAFSESEK
DTLPYEELQGLKVASEAPLEHKPQVEASSPRLNPAVTCAGKGTPLTPPACACSSLQVEVE
RLQGLVLKCLAEQQKLQQENLQIFTQLQKLNKKLEGGQQVGMHSKGTQTAKEEMEMDPKP
DLDSDSWCLLGTDSCRPSL
GenBank ID Protein 222136641
UniProtKB/Swiss-Prot ID Q8TD19
UniProtKB/Swiss-Prot Entry Name NEK9_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_033116.4
GeneCard ID NEK9
GenAtlas ID NEK9
HGNC ID HGNC:18591
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  7. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  9. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121 ]
  10. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  11. Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. Mol Cell Proteomics. 2007 Mar;6(3):537-47. Epub 2006 Dec 27. [PubMed:17192257 ]
  12. Rapley J, Nicolas M, Groen A, Regue L, Bertran MT, Caelles C, Avruch J, Roig J: The NIMA-family kinase Nek6 phosphorylates the kinesin Eg5 at a novel site necessary for mitotic spindle formation. J Cell Sci. 2008 Dec 1;121(Pt 23):3912-21. doi: 10.1242/jcs.035360. Epub 2008 Nov 11. [PubMed:19001501 ]
  13. Holland PM, Milne A, Garka K, Johnson RS, Willis C, Sims JE, Rauch CT, Bird TA, Virca GD: Purification, cloning, and characterization of Nek8, a novel NIMA-related kinase, and its candidate substrate Bicd2. J Biol Chem. 2002 May 3;277(18):16229-40. Epub 2002 Feb 25. [PubMed:11864968 ]
  14. Roig J, Mikhailov A, Belham C, Avruch J: Nercc1, a mammalian NIMA-family kinase, binds the Ran GTPase and regulates mitotic progression. Genes Dev. 2002 Jul 1;16(13):1640-58. [PubMed:12101123 ]
  15. Ohara O, Nagase T, Mitsui G, Kohga H, Kikuno R, Hiraoka S, Takahashi Y, Kitajima S, Saga Y, Koseki H: Characterization of size-fractionated cDNA libraries generated by the in vitro recombination-assisted method. DNA Res. 2002 Apr 30;9(2):47-57. [PubMed:12056414 ]
  16. Tan BC, Lee SC: Nek9, a novel FACT-associated protein, modulates interphase progression. J Biol Chem. 2004 Mar 5;279(10):9321-30. Epub 2003 Dec 2. [PubMed:14660563 ]