You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01301
Secondary Accession Numbers
  • 6597
Name Potassium-transporting ATPase alpha chain 2
Synonyms
  1. Non-gastric H(+)/K(+) ATPase subunit alpha
  2. Proton pump
Gene Name ATP12A
Protein Type Enzyme
Biological Properties
General Function Involved in ATP binding
Specific Function Catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. Responsible for potassium absorption in various tissues.
Pathways
  • Oxidative phosphorylation
Reactions Not Available
GO Classification
Biological Process
ATP biosynthetic process
ion transmembrane transport
potassium ion homeostasis
response to metal ion
response to organic cyclic compound
Cellular Component
hydrogen:potassium-exchanging ATPase complex
apical plasma membrane
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
binding
catalytic activity
hydrolase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
transporter activity
atpase activity, coupled to transmembrane movement of ions
atpase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
hydrolase activity, acting on acid anhydrides
Molecular Function
metal ion binding
ATP binding
hydrogen:potassium-exchanging ATPase activity
Process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
establishment of localization
transport
monovalent inorganic cation transport
ion transport
atp biosynthetic process
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 13
Locus 13q12.1-q12.3
SNPs ATP12A
Gene Sequence
>3120 bp
ATGCACCAGAAAACCCCAGAAATTTACTCCGTGGAGCTCAGCGGAACTAAGGACATCGTG
AAAACAGACAAGGGGGATGGCAAGGAGAAGTATAGGGGTCTGAAGAACAACTGCCTGGAA
CTCAAAAAGAAAAATCACAAAGAGGAGTTTCAGAAAGAACTCCATCTGGATGACCACAAA
CTCAGCAATAGGGAATTGGAAGAGAAATATGGCACAGACATCATTATGGGTCTCTCCAGC
ACCAGAGCTGCCGAGCTCCTGGCCCGGGATGGGCCCAACTCCCTCACCCCTCCCAAGCAG
ACGCCTGAGATCGTCAAGTTCCTCAAGCAGATGGTGGGGGGGTTCTCTATCCTCCTGTGG
GTGGGCGCCTTTCTCTGTTGGATTGCATATGGGATTCAGTACTCCAGCGACAAGTCTGCA
TCCCTGAACAACGTGTACTTGGGCTGTGTGCTTGGTCTGGTGGTCATTTTAACGGGGATC
TTTGCTTATTACCAAGAGGCAAAAAGCACCAACATCATGTCCAGCTTCAATAAGATGATC
CCTCAGCAAGCTCTCGTCATCCGAGATTCCGAGAAGAAGACCATCCCTTCAGAGCAGCTG
GTGGTGGGGGACATTGTGGAGGTCAAAGGAGGAGACCAGATCCCTGCAGACATCAGGGTG
CTGTCTTCTCAGGGGTGTCGGGTGGATAACTCATCTCTCACGGGGGAGTCTGAGCCCCAG
CCCCGCTCCTCTGAGTTTACCCATGAAAACCCCCTGGAAACAAAGAACATCTGCTTCTAT
TCCACAACGTGTCTGGAAGGCACTGTCACCGGCATGGTTATCAACACGGGTGACCGCACC
ATCATTGGCCATATTGCCTCATTGGCCTCAGGAGTTGGAAATGAGAAGACGCCCATTGCC
ATTGAGATCGAGCACTTTGTTCACATTGTGGCAGGAGTGGCTGTCTCCATCGGCATCCTT
TTCTTCATCATCGCTGTGTCCCTGAAGTATCAAGTCCTGGACTCCATCATCTTCCTCATT
GGCATCATTGTGGCCAATGTGCCCGAGGGCCTCCTGGCCACTGTCACTGTGACCCTGTCG
CTGACAGCAAAACGGATGGCCAAGAAGAACTGCCTGGTGAAGAACCTGGAGGCTGTGGAG
ACCCTCGGCTCCACCTCCATCATCTGCTCGGACAAGACTGGGACACTGACCCAGAACAGG
ATGACAGTGGCCCATCTGTGGTTCGACAATCAGATCTTTGTGGCTGACACCAGTGAGGAC
CATTCAAACCAAGTCTTTGACCAAAGCTCTAGGACTTGGGCCTCCTTATCCAAGATAATA
ACATTGTGTAACCGAGCAGAGTTCAAGCCAGGACAGGAAAATGTCCCCATCATGAAGAAA
GCTGTGATTGGAGATGCCTCAGAAACTGCTCTTTTAAAATTCTCAGAGGTCATTTTGGGT
GATGTGATGGAAATTAGAAAAAGAAACCGCAAAGTAGCTGAAATCCCTTTTAACTCTACT
AATAAATTTCAGCTCTCCATCCACGAGATGGATGACCCCCACGGCAAGCGCTTCCTCATG
GTGATGAAGGGGGCCCCTGAGCGCATTCTAGAGAAATGCAGCACCATCATGATCAACGGC
GAGGAGCACCCACTGGACAAGAGCACTGCCAAGACCTTCCACACAGCCTACATGGAGCTG
GGCGGGTTGGGCGAGCGTGTGCTGGGTTTCTGTCATCTCTACCTGCCAGCAGACGAGTTT
CCAGAAACCTACTCATTTGACATAGACGCTATGAACTTTCCGACCTCCAACCTCTGTTTT
GTGGGACTCTTGTCAATGATCGATCCCCCTCGGTCCACCGTGCCAGATGCAGTCACCAAA
TGCCGGAGTGCAGGGATCAAGGTTATTATGGTTACTGGTGATCATCCCATCACAGCCAAA
GCTATTGCCAAGAGTGTGGGGATCATTTCAGCCAACAGTGAAACAGTGGAAGACATTGCA
CATCGCCTCAACATTGCTGTGGAGCAAGTTAACAAACGGGATGCCAAGGCCGCTGTGGTG
ACTGGCATGGAGCTGAAGGACATGAGCTCAGAACAGCTGGATGAGATCTTAGCCAACTAC
CAGGAGATTGTCTTTGCCCGGACATCCCCCCAGCAGAAGCTGATCATTGTGGAGGGCTGT
CAGAGGCAGGATGCTGTTGTTGCTGTGACCGGGGATGGAGTTAATGACTCTCCGGCTCTA
AAGAAGGCAGACATTGGGATTGCCATGGGGATAGCAGGTTCTGATGCAGCCAAAAATGCA
GCCGACATGGTCTTGCTGGACGACAACTTCGCATCCATCGTCACAGGGGTGGAGGAAGGT
CGCCTGATCTTTGACAACCTCAAGAAGACTATTGCTTATTCCCTGACCAAGAACATTGCC
GAGCTGTGCCCCTTTCTGATCTACATCATTGTCGGGCTCCCCCTGCCCATTGGCACCATC
ACCATTCTGTTCATTGACTTGGGGACAGACATTATCCCCTCCATTGCCTTGGCGTACGAG
AAAGCTGAAAGTGACATCATGAACAGGAAGCCTCGCCACAAGAATAAGGACAGGCTGGTG
AACCAGCCGCTCGCTGTGTACTCATACCTGCACATTGGCCTCATGCAAGCCCTGGGAGCT
TTCCTTGTGTATTTCACCGTCTATGCACAAGAGGGCTTTCTGCCCCGCACTCTCATTAAC
CTGCGGGTAGAATGGGAGAAGGACTACGTGAATGACTTGAAAGACAGCTATGGGCAGGAA
TGGACAAGGTACCAGAGGGAATACCTAGAATGGACGGGCTACACGGCTTTCTTTGTTGGC
ATCCTAGTCCAGCAAATAGCAGATCTGATCATCAGGAAAACCCGGAGGAATTCCATCTTC
CAGCAGGGTCTCTTCAGAAATAAAGTCATCTGGGTGGGGATCACCTCACAGATCATCATT
GGTCTGATCCTCTCCTATGGCCTCGGAAGTGTCACAGCCTTGAGTTTCACCATGCTTAGG
GCTCAGTACTGGTTTGTGGCTGTGCCGCACGCCATCCTGATCTGGGTGTATGATGAGGTG
CGGAAGCTCTTCATCAGGCTCTACCCTGGAAGCTGGTGGGATAAGAACATGTATTATTAA
Protein Properties
Number of Residues 1039
Molecular Weight 116052.03
Theoretical pI 6.551
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Potassium-transporting ATPase alpha chain 2
MHQKTPEIYSVELSGTKDIVKTDKGDGKEKYRGLKNNCLELKKKNHKEEFQKELHLDDHK
LSNRELEEKYGTDIIMGLSSTRAAELLARDGPNSLTPPKQTPEIVKFLKQMVGGFSILLW
VGAFLCWIAYGIQYSSDKSASLNNVYLGCVLGLVVILTGIFAYYQEAKSTNIMSSFNKMI
PQQALVIRDSEKKTIPSEQLVVGDIVEVKGGDQIPADIRVLSSQGCRVDNSSLTGESEPQ
PRSSEFTHENPLETKNICFYSTTCLEGTVTGMVINTGDRTIIGHIASLASGVGNEKTPIA
IEIEHFVHIVAGVAVSIGILFFIIAVSLKYQVLDSIIFLIGIIVANVPEGLLATVTVTLS
LTAKRMAKKNCLVKNLEAVETLGSTSIICSDKTGTLTQNRMTVAHLWFDNQIFVADTSED
HSNQVFDQSSRTWASLSKIITLCNRAEFKPGQENVPIMKKAVIGDASETALLKFSEVILG
DVMEIRKRNRKVAEIPFNSTNKFQLSIHEMDDPHGKRFLMVMKGAPERILEKCSTIMING
EEHPLDKSTAKTFHTAYMELGGLGERVLGFCHLYLPADEFPETYSFDIDAMNFPTSNLCF
VGLLSMIDPPRSTVPDAVTKCRSAGIKVIMVTGDHPITAKAIAKSVGIISANSETVEDIA
HRLNIAVEQVNKRDAKAAVVTGMELKDMSSEQLDEILANYQEIVFARTSPQQKLIIVEGC
QRQDAVVAVTGDGVNDSPALKKADIGIAMGIAGSDAAKNAADMVLLDDNFASIVTGVEEG
RLIFDNLKKTIAYSLTKNIAELCPFLIYIIVGLPLPIGTITILFIDLGTDIIPSIALAYE
KAESDIMNRKPRHKNKDRLVNQPLAVYSYLHIGLMQALGAFLVYFTVYAQEGFLPRTLIN
LRVEWEKDYVNDLKDSYGQEWTRYQREYLEWTGYTAFFVGILVQQIADLIIRKTRRNSIF
QQGLFRNKVIWVGITSQIIIGLILSYGLGSVTALSFTMLRAQYWFVAVPHAILIWVYDEV
RKLFIRLYPGSWWDKNMYY
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P54707
UniProtKB/Swiss-Prot Entry Name AT12A_HUMAN
PDB IDs Not Available
GenBank Gene ID U02076
GeneCard ID ATP12A
GenAtlas ID ATP12A
HGNC ID HGNC:13816
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823 ]
  4. Grishin AV, Sverdlov VE, Kostina MB, Modyanov NN: Cloning and characterization of the entire cDNA encoded by ATP1AL1--a member of the human Na,K/H,K-ATPase gene family. FEBS Lett. 1994 Jul 25;349(1):144-50. [PubMed:8045293 ]
  5. Sverdlov VE, Kostina MB, Modyanov NN: Genomic organization of the human ATP1AL1 gene encoding a ouabain-sensitive H,K-ATPase. Genomics. 1996 Mar 15;32(3):317-27. [PubMed:8838794 ]
  6. Modyanov NN, Petrukhin KE, Sverdlov VE, Grishin AV, Orlova MY, Kostina MB, Makarevich OI, Broude NE, Monastyrskaya GS, Sverdlov ED: The family of human Na,K-ATPase genes. ATP1AL1 gene is transcriptionally competent and probably encodes the related ion transport ATPase. FEBS Lett. 1991 Jan 14;278(1):91-4. [PubMed:1847115 ]
  7. Shull MM, Lingrel JB: Multiple genes encode the human Na+,K+-ATPase catalytic subunit. Proc Natl Acad Sci U S A. 1987 Jun;84(12):4039-43. [PubMed:3035563 ]
  8. Sverdlov ED, Monastyrskaya GS, Broude NE, Ushkaryov YuA, Allikmets RL, Melkov AM, Smirnov YuV, Malyshev IV, Dulobova IE, Petrukhin KE, et al.: The family of human Na+,K+-ATPase genes. No less than five genes and/or pseudogenes related to the alpha-subunit. FEBS Lett. 1987 Jun 15;217(2):275-8. [PubMed:3036582 ]
  9. Pestov NB, Romanova LG, Korneenko TV, Egorov MV, Kostina MB, Sverdlov VE, Askari A, Shakhparonov MI, Modyanov NN: Ouabain-sensitive H,K-ATPase: tissue-specific expression of the mammalian genes encoding the catalytic alpha subunit. FEBS Lett. 1998 Dec 4;440(3):320-4. [PubMed:9872395 ]