Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01308
Secondary Accession Numbers
  • 6604
Name Serine/threonine-protein kinase ATR
Synonyms
  1. Ataxia telangiectasia and Rad3-related protein
  2. FRAP-related protein 1
Gene Name ATR
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Serine/threonine protein kinase which activates checkpoint signaling upon genotoxic stresses such as ionizing radiation (IR), ultraviolet light (UV), or DNA replication stalling, thereby acting as a DNA damage sensor. Recognizes the substrate consensus sequence [ST]-Q. Phosphorylates BRCA1, CHEK1, MCM2, RAD17, RPA2, SMC1 and TP53/p53, which collectively inhibit DNA replication and mitosis and promote DNA repair, recombination and apoptosis. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX at sites of DNA damage, thereby regulating DNA damage response mechanism. Required for FANCD2 ubiquitination. Critical for maintenance of fragile site stability and efficient regulation of centrosome duplication
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
phosphotransferase activity, alcohol group as acceptor
protein kinase activity
protein serine/threonine kinase activity
Cellular Location
  1. Nucleus
  2. Nucleus
  3. PML body
Gene Properties
Chromosome Location Chromosome:3
Locus 3q22-q24
SNPs ATR
Gene Sequence
>7935 bp
ATGGGGGAACATGGCCTGGAGCTGGCTTCCATGATCCCCGCCCTGCGGGAGCTGGGCAGT
GCCACACCAGAGGAATATAATACAGTTGTACAGAAGCCAAGACAAATTCTGTGTCAATTC
ATTGACCGGATACTTACAGATGTAAATGTTGTTGCTGTAGAACTTGTAAAGAAAACTGAC
TCTCAGCCAACCTCCGTGATGTTGCTTGATTTCATCCAGCATATCATGAAATCCTCCCCA
CTTATGTTTGTAAATGTGAGTGGAAGCCATGAGGCCAAAGGCAGTTGTATTGAATTCAGT
AATTGGATCATAACGAGACTTCTGCGGATTGCAGCAACTCCCTCCTGTCATTTGTTACAC
AAGAAAATCTGTGAAGTCATCTGTTCATTATTATTTCTTTTTAAAAGCAAGAGTCCTGCT
ATTTTTGGGGTACTCACAAAAGAATTATTACAACTTTTTGAAGACTTGGTTTACCTCCAT
AGAAGAAATGTGATGGGTCATGCTGTGGAATGGCCAGTGGTCATGAGCCGATTTTTAAGT
CAATTAGATGAACACATGGGATATTTACAATCAGCTCCTTTGCAGTTGATGAGTATGCAA
AATTTAGAATTTATTGAAGTCACTTTATTAATGGTTCTTACTCGTATTATTGCAATTGTG
TTTTTTAGAAGGCAAGAACTCTTACTTTGGCAGATAGGTTGTGTTCTGCTAGAGTATGGT
AGTCCAAAAATTAAATCCCTAGCAATTAGCTTTTTAACAGAACTTTTTCAGCTTGGAGGA
CTACCAGCACAACCAGCTAGCACTTTTTTCAGCTCATTTTTGGAATTATTAAAACACCTT
GTAGAAATGGATACTGACCAATTGAAACTCTATGAAGAGCCATTATCAAAGCTGATAAAG
ACACTATTTCCCTTTGAAGCAGAAGCTTATAGAAATATTGAACCTGTCTATTTAAATATG
CTGCTGGAAAAACTCTGTGTCATGTTTGAAGACGGTGTGCTCATGCGGCTTAAGTCTGAT
TTGCTAAAAGCAGCTTTGTGCCATTTACTGCAGTATTTCCTTAAATTTGTGCCAGCTGGG
TATGAATCTGCTTTACAAGTCAGGAAGGTCTATGTGAGAAATATTTGTAAAGCTCTTTTG
GATGTGCTTGGAATTGAGGTAGATGCAGAGTACTTGTTGGGCCCACTTTATGCAGCTTTG
AAAATGGAAAGTATGGAAATCATTGAGGAGATTCAATGCCAAACTCAACAGGAAAACCTC
AGCAGTAATAGTGATGGAATATCACCCAAAAGGCGTCGTCTCAGCTCGTCTCTAAACCCT
TCTAAAAGAGCACCAAAACAGACTGAGGAAATTAAACATGTGGACATGAACCAAAAGAGC
ATATTATGGAGTGCACTGAAACAGAAAGCTGAATCCCTTCAGATTTCCCTTGAATACAGT
GGCCTAAAGAATCCTGTTATTGAGATGTTAGAAGGAATTGCTGTTGTCTTACAACTGACT
GCTCTGTGTACTGTTCATTGTTCTCATCAAAACATGAACTGCCGTACTTTCAAGGACTGT
CAACATAAATCCAAGAAGAAACCTTCTGTAGTGATAACTTGGATGTCATTGGATTTTTAC
ACAAAAGTGCTTAAGAGCTGTAGAAGTTTGTTAGAATCTGTTCAGAAACTGGACCTGGAG
GCAACCATTGATAAGGTGGTGAAAATTTATGATGCTTTGATTTATATGCAAGTAAACAGT
TCATTTGAAGATCATATCCTGGAAGATTTATGTGGTATGCTCTCACTTCCATGGATTTAT
TCCCATTCTGATGATGGCTGTTTAAAGTTGACCACATTTGCCGCTAATCTTCTAACATTA
AGCTGTAGGATTTCAGATAGCTATTCACCACAGGCACAATCACGATGTGTGTTTCTTCTG
ACTCTGTTTCCAAGAAGAATATTCCTTGAGTGGAGAACAGCAGTTTACAACTGGGCCCTG
CAGAGCTCCCATGAAGTAATCCGGGCTAGTTGTGTTAGTGGATTTTTTATCTTATTGCAG
CAGCAGAATTCTTGTAACAGAGTTCCCAAGATTCTTATAGATAAAGTCAAAGATGATTCT
GACATTGTCAAGAAAGAATTTGCTTCTATACTTGGTCAACTTGTCTGTACTCTTCACGGC
ATGTTTTATCTGACAAGTTCTTTAACAGAACCTTTCTCTGAACACGGACATGTGGACCTC
TTCTGTAGGAACTTGAAAGCCACTTCTCAACATGAATGTTCATCTTCTCAACTAAAAGCT
TCTGTCTGCAAGCCATTCCTTTTCCTACTGAAAAAAAAAATACCTAGTCCAGTAAAACTT
GCTTTCATAGATAATCTACATCATCTTTGTAAGCATCTTGATTTTAGAGAAGATGAAACA
GATGTAAAAGCAGTTCTTGGAACTTTATTAAATTTAATGGAAGATCCAGACAAAGATGTT
AGAGTGGCTTTTAGTGGAAATATCAAGCACATATTGGAATCCTTGGACTCTGAAGATGGA
TTTATAAAGGAGCTTTTTGTCTTAAGAATGAAGGAAGCATATACACATGCCCAAATATCA
AGAAATAATGAGCTGAAGGATACCTTGATTCTTACAACAGGGGATATTGGAAGGGCCGCA
AAAGGAGATTTGGTACCATTTGCACTCTTACACTTATTGCATTGTTTGTTATCCAAGTCA
GCATCTGTCTCTGGAGCAGCATACACAGAAATTAGAGCTCTGGTTGCAGCTAAAAGTGTT
AAACTGCAAAGTTTTTTCAGCCAGTATAAGAAACCCATCTGTCAGTTTTTGGTAGAATCC
CTTCACTCTAGTCAGATGACAGCACTTCCGAATACTCCATGCCAGAATGCTGACGTGCGA
AAACAAGATGTGGCTCACCAGAGAGAAATGGCTTTAAATACGTTGTCTGAAATTGCCAAC
GTTTTCGACTTTCCTGATCTTAATCGTTTTCTTACTAGGACATTACAAGTTCTACTACCT
GATCTTGCTGCCAAAGCAAGCCCTGCAGCTTCTGCTCTCATTCGAACTTTAGGAAAACAA
TTAAATGTCAATCGTAGAGAGATTTTAATAAACAACTTCAAATATATTTTTTCTCATTTG
GTCTGTTCTTGTTCCAAAGATGAATTAGAACGTGCCCTTCATTATCTGAAGAATGAAACA
GAAATTGAACTGGGGAGCCTGTTGAGACAAGATTTCCAAGGATTGCATAATGAATTATTG
CTGCGTATTGGAGAACACTATCAACAGGTTTTTAATGGTTTGTCAATACTTGCCTCATTT
GCATCCAGTGATGATCCATATCAGGGCCCGAGAGATATCATATCACCTGAACTGATGGCT
GATTATTTACAACCCAAATTGTTGGGCATTTTGGCTTTTTTTAACATGCAGTTACTGAGC
TCTAGTGTTGGCATTGAAGATAAGAAAATGGCCTTGAACAGTTTGATGTCTTTGATGAAG
TTAATGGGACCCAAACATGTCAGTTCTGTGAGGGTGAAGATGATGACCACACTGAGAACT
GGCCTTCGATTCAAGGATGATTTTCCTGAATTGTGTTGCAGAGCTTGGGACTGCTTTGTT
CGCTGCCTGGATCATGCTTGTCTGGGCTCCCTTCTCAGTCATGTAATAGTAGCTTTGTTA
CCTCTTATACACATCCAGCCTAAAGAAACTGCAGCTATCTTCCACTACCTCATAATTGAA
AACAGGGATGCTGTGCAAGATTTTCTTCATGAAATATATTTTTTACCTGATCATCCAGAA
TTAAAAAAGATAAAAGCCGTTCTCCAGGAATACAGAAAGGAGACCTCTGAGAGCACTGAT
CTTCAGACAACTCTTCAGCTCTCTATGAAGGCCATTCAACATGAAAATGTCGATGTTCGT
ATTCATGCTCTTACAAGCTTGAAGGAAACCTTGTATAAAAATCAGGAAAAACTGATAAAG
TATGCAACAGACAGTGAAACAGTAGAACCTATTATCTCACAGTTGGTGACAGTGCTTTTG
AAAGGTTGCCAAGATGCAAACTCTCAAGCTCGGTTGCTCTGTGGGGAATGTTTAGGGGAA
TTGGGGGCGATAGATCCAGGTCGATTAGATTTCTCAACAACTGAAACTCAAGGAAAAGAT
TTTACATTTGTGACTGGAGTAGAAGATTCAAGCTTTGCCTATGGATTATTGATGGAGCTA
ACAAGAGCTTACCTTGCGTATGCTGATAATAGCCGAGCTCAAGATTCAGCTGCCTATGCC
ATTCAGGAGTTGCTTTCTATTTATGACTGTAGAGAGATGGAGACCAACGGCCCAGGTCAC
CAATTGTGGAGGAGATTTCCTGAGCATGTTCGGGAAATACTAGAACCTCATCTAAATACC
AGATACAAGAGTTCTCAGAAGTCAACCGATTGGTCTGGAGTAAAGAAGCCAATTTACTTA
AGTAAATTGGGTAGTAACTTTGCAGAATGGTCAGCATCTTGGGCAGGTTATCTTATTACA
AAGGTTCGACATGATCTTGCCAGTAAAATTTTCACCTGCTGTAGCATTATGATGAAGCAT
GATTTCAAAGTGACCATCTATCTTCTTCCACATATTCTGGTGTATGTCTTACTGGGTTGT
AATCAAGAAGATCAGCAGGAGGTTTATGCAGAAATTATGGCAGTTCTAAAGCATGACGAT
CAGCATACCATAAATACCCAAGACATTGCATCTGATCTGTGTCAACTCAGTACACAGACT
GTGTTCTCCATGCTTGACCATCTCACACAGTGGGCAAGGCACAAATTTCAGGCACTGAAA
GCTGAGAAATGTCCACACAGCAAATCAAACAGAAATAAGGTAGACTCAATGGTATCTACT
GTGGATTATGAAGACTATCAGAGTGTAACCCGTTTTCTAGACCTCATACCCCAGGATACT
CTGGCAGTAGCTTCCTTTCGCTCCAAAGCATACACACGAGCTGTAATGCACTTTGAATCA
TTTATTACAGAAAAGAAGCAAAATATTCAGGAACATCTTGGATTTTTACAGAAATTGTAT
GCTGCTATGCATGAACCTGATGGAGTGGCCGGAGTCAGTGCAATTAGAAAGGCAGAACCA
TCTCTAAAAGAACAGATCCTTGAACATGAAAGCCTTGGCTTGCTGAGGGATGCCACTGCT
TGTTATGACAGGGCTATTCAGCTAGAACCAGACCAGATCATTCATTATCATGGTGTAGTA
AAGTCCATGTTAGGTCTTGGTCAGCTGTCTACTGTTATCACTCAGGTGAATGGAGTGCAT
GCTAACAGGTCCGAGTGGACAGATGAATTAAACACGTACAGAGTGGAAGCAGCTTGGAAA
TTGTCACAGTGGGATTTGGTGGAAAACTATTTGGCAGCAGATGGAAAATCTACAACATGG
AGTGTCAGACTGGGACAGCTATTATTATCAGCCAAAAAAAGAGATATCACAGCTTTTTAT
GACTCACTGAAACTAGTGAGAGCAGAACAAATTGTACCTCTTTCAGCTGCAAGCTTTGAA
AGAGGCTCCTACCAACGAGGATATGAATATATTGTGAGATTGCACATGTTATGTGAGTTG
GAGCATAGCATCAAACCACTTTTCCAGCATTCTCCAGGTGACAGTTCTCAAGAAGATTCT
CTAAACTGGGTAGCTCGACTAGAAATGACCCAGAATTCCTACAGAGCCAAGGAGCCTATC
CTGGCTCTCCGGAGGGCTTTACTAAGCCTCAACAAAAGACCAGATTACAATGAAATGGTT
GGAGAATGCTGGCTGCAGAGTGCCAGGGTAGCTAGAAAGGCTGGTCACCACCAGACAGCC
TACAATGCTCTCCTTAATGCAGGGGAATCACGACTCGCTGAACTGTACGTGGAAAGGGCA
AAGTGGCTCTGGTCCAAGGGTGATGTTCACCAGGCACTAATTGTTCTTCAAAAAGGTGTT
GAATTATGTTTTCCTGAAAATGAAACCCCACCTGAGGGTAAGAACATGTTAATCCATGGT
CGAGCTATGCTACTAGTGGGCCGATTTATGGAAGAAACAGCTAACTTTGAAAGCAATGCA
ATTATGAAAAAATATAAGGATGTGACCGCGTGCCTGCCAGAATGGGAGGATGGGCATTTT
TACCTTGCCAAGTACTATGACAAATTGATGCCCATGGTCACAGACAACAAAATGGAAAAG
CAAGGTGATCTCATCCGGTATATAGTTCTTCATTTTGGCAGATCTCTACAATATGGAAAT
CAGTTCATATATCAGTCAATGCCACGAATGTTAACTCTATGGCTTGATTATGGTACAAAG
GCATATGAATGGGAAAAAGCTGGCCGCTCCGATCGTGTACAAATGAGGAATGATTTGGGT
AAAATAAACAAGGTTATCACAGAGCATACAAACTATTTAGCTCCATATCAATTTTTGACT
GCTTTTTCACAATTGATCTCTCGAATTTGTCATTCTCACGATGAAGTTTTTGTTGTCTTG
ATGGAAATAATAGCCAAAGTATTTCTAGCCTATCCTCAACAAGCAATGTGGATGATGACA
GCTGTGTCAAAGTCATCTTATCCCATGCGTGTGAACAGATGCAAGGAAATCCTCAATAAA
GCTATTCATATGAAAAAATCCTTAGAGAAGTTTGTTGGAGATGCAACTCGCCTAACAGAT
AAGCTTCTAGAATTGTGCAATAAACCGGTTGATGGAAGTAGTTCCACATTAAGCATGAGC
ACTCATTTTAAAATGCTTAAAAAGCTGGTAGAAGAAGCAACATTTAGTGAAATCCTCATT
CCTCTACAATCAGTCATGATACCTACACTTCCATCAATTCTGGGTACCCATGCTAACCAT
GCTAGCCATGAACCATTTCCTGGACATTGGGCCTATATTGCAGGGTTTGATGATATGGTG
GAAATTCTTGCTTCTCTTCAGAAACCAAAGAAGATTTCTTTAAAAGGCTCAGATGGAAAG
TTCTACATCATGATGTGTAAGCCAAAAGATGACCTGAGAAAGGATTGTAGACTAATGGAA
TTCAATTCCTTGATTAATAAGTGCTTAAGAAAAGATGCAGAGTCTCGTAGAAGAGAACTT
CATATTCGAACATATGCAGTTATTCCACTAAATGATGAATGTGGGATTATTGAATGGGTG
AACAACACTGCTGGTTTGAGACCTATTCTGACCAAACTATATAAAGAAAAGGGAGTGTAT
ATGACAGGAAAAGAACTTCGCCAGTGTATGCTACCAAAGTCAGCAGCTTTATCTGAAAAA
CTCAAAGTATTCCGAGAATTTCTCCTGCCCAGGCATCCTCCTATTTTTCATGAGTGGTTT
CTGAGAACATTCCCTGATCCTACATCATGGTACAGTAGTAGATCAGCTTACTGCCGTTCC
ACTGCAGTAATGTCAATGGTTGGTTATATTCTGGGGCTTGGAGACCGTCATGGTGAAAAT
ATTCTCTTTGATTCTTTGACTGGTGAATGCGTACATGTAGATTTCAATTGTCTTTTCAAT
AAGGGAGAAACCTTTGAAGTTCCAGAAATTGTGCCATTTCGCCTGACTCATAATATGGTT
AATGGAATGGGTCCTATGGGAACAGAGGGTCTTTTTCGAAGAGCATGTGAAGTTACAATG
AGGCTGATGCGTGATCAGCGAGAGCCTTTAATGAGTGTCTTAAAGACTTTTCTACATGAT
CCTCTTGTGGAATGGAGTAAACCAGTGAAAGGGCATTCCAAAGCGCCACTGAATGAAACT
GGAGAAGTTGTCAATGAAAAGGCCAAGACCCATGTTCTTGACATTGAGCAGCGACTACAA
GGTGTAATCAAGACTCGAAATAGAGTGACAGGACTGCCGTTATCTATTGAAGGACATGTG
CATTACCTTATACAGGAAGCTACTGATGAAAACTTACTATGCCAGATGTATCTTGGTTGG
ACTCCATATATGTGA
Protein Properties
Number of Residues 2644
Molecular Weight 301363.7
Theoretical pI 7.44
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase ATR
MGEHGLELASMIPALRELGSATPEEYNTVVQKPRQILCQFIDRILTDVNVVAVELVKKTD
SQPTSVMLLDFIQHIMKSSPLMFVNVSGSHEAKGSCIEFSNWIITRLLRIAATPSCHLLH
KKICEVICSLLFLFKSKSPAIFGVLTKELLQLFEDLVYLHRRNVMGHAVEWPVVMSRFLS
QLDEHMGYLQSAPLQLMSMQNLEFIEVTLLMVLTRIIAIVFFRRQELLLWQIGCVLLEYG
SPKIKSLAISFLTELFQLGGLPAQPASTFFSSFLELLKHLVEMDTDQLKLYEEPLSKLIK
TLFPFEAEAYRNIEPVYLNMLLEKLCVMFEDGVLMRLKSDLLKAALCHLLQYFLKFVPAG
YESALQVRKVYVRNICKALLDVLGIEVDAEYLLGPLYAALKMESMEIIEEIQCQTQQENL
SSNSDGISPKRRRLSSSLNPSKRAPKQTEEIKHVDMNQKSILWSALKQKAESLQISLEYS
GLKNPVIEMLEGIAVVLQLTALCTVHCSHQNMNCRTFKDCQHKSKKKPSVVITWMSLDFY
TKVLKSCRSLLESVQKLDLEATIDKVVKIYDALIYMQVNSSFEDHILEDLCGMLSLPWIY
SHSDDGCLKLTTFAANLLTLSCRISDSYSPQAQSRCVFLLTLFPRRIFLEWRTAVYNWAL
QSSHEVIRASCVSGFFILLQQQNSCNRVPKILIDKVKDDSDIVKKEFASILGQLVCTLHG
MFYLTSSLTEPFSEHGHVDLFCRNLKATSQHECSSSQLKASVCKPFLFLLKKKIPSPVKL
AFIDNLHHLCKHLDFREDETDVKAVLGTLLNLMEDPDKDVRVAFSGNIKHILESLDSEDG
FIKELFVLRMKEAYTHAQISRNNELKDTLILTTGDIGRAAKGDLVPFALLHLLHCLLSKS
ASVSGAAYTEIRALVAAKSVKLQSFFSQYKKPICQFLVESLHSSQMTALPNTPCQNADVR
KQDVAHQREMALNTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTLGKQ
LNVNRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHNELL
LRIGEHYQQVFNGLSILASFASSDDPYQGPRDIISPELMADYLQPKLLGILAFFNMQLLS
SSVGIEDKKMALNSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWDCFV
RCLDHACLGSLLSHVIVALLPLIHIQPKETAAIFHYLIIENRDAVQDFLHEIYFLPDHPE
LKKIKAVLQEYRKETSESTDLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEKLIK
YATDSETVEPIISQLVTVLLKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQGKD
FTFVTGVEDSSFAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGH
QLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVKKPIYLSKLGSNFAEWSASWAGYLIT
KVRHDLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCNQEDQQEVYAEIMAVLKHDD
QHTINTQDIASDLCQLSTQTVFSMLDHLTQWARHKFQALKAEKCPHSKSNRNKVDSMVST
VDYEDYQSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQNIQEHLGFLQKLY
AAMHEPDGVAGVSAIRKAEPSLKEQILEHESLGLLRDATACYDRAIQLEPDQIIHYHGVV
KSMLGLGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAADGKSTTW
SVRLGQLLLSAKKRDITAFYDSLKLVRAEQIVPLSAASFERGSYQRGYEYIVRLHMLCEL
EHSIKPLFQHSPGDSSQEDSLNWVARLEMTQNSYRAKEPILALRRALLSLNKRPDYNEMV
GECWLQSARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQKGV
ELCFPENETPPEGKNMLIHGRAMLLVGRFMEETANFESNAIMKKYKDVTACLPEWEDGHF
YLAKYYDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQYGNQFIYQSMPRMLTLWLDYGTK
AYEWEKAGRSDRVQMRNDLGKINKVITEHTNYLAPYQFLTAFSQLISRICHSHDEVFVVL
MEIIAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNKAIHMKKSLEKFVGDATRLTD
KLLELCNKPVDGSSSTLSMSTHFKMLKKLVEEATFSEILIPLQSVMIPTLPSILGTHANH
ASHEPFPGHWAYIAGFDDMVEILASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLME
FNSLINKCLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVY
MTGKELRQCMLPKSAALSEKLKVFREFLLPRHPPIFHEWFLRTFPDPTSWYSSRSAYCRS
TAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMV
NGMGPMGTEGLFRRACEVTMRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNET
GEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGW
TPYM
GenBank ID Protein 157266317
UniProtKB/Swiss-Prot ID Q13535
UniProtKB/Swiss-Prot Entry Name ATR_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001184.3
GeneCard ID ATR
GenAtlas ID ATR
HGNC ID HGNC:882
References
General References
  1. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  2. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  3. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  4. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  5. Sarkaria JN, Tibbetts RS, Busby EC, Kennedy AP, Hill DE, Abraham RT: Inhibition of phosphoinositide 3-kinase related kinases by the radiosensitizing agent wortmannin. Cancer Res. 1998 Oct 1;58(19):4375-82. [PubMed:9766667 ]
  6. Bao S, Tibbetts RS, Brumbaugh KM, Fang Y, Richardson DA, Ali A, Chen SM, Abraham RT, Wang XF: ATR/ATM-mediated phosphorylation of human Rad17 is required for genotoxic stress responses. Nature. 2001 Jun 21;411(6840):969-74. [PubMed:11418864 ]
  7. Park BJ, Kang JW, Lee SW, Choi SJ, Shin YK, Ahn YH, Choi YH, Choi D, Lee KS, Kim S: The haploinsufficient tumor suppressor p18 upregulates p53 via interactions with ATM/ATR. Cell. 2005 Jan 28;120(2):209-21. [PubMed:15680327 ]
  8. Sivasubramaniam S, Sun X, Pan YR, Wang S, Lee EY: Cep164 is a mediator protein required for the maintenance of genomic stability through modulation of MDC1, RPA, and CHK1. Genes Dev. 2008 Mar 1;22(5):587-600. doi: 10.1101/gad.1627708. Epub 2008 Feb 18. [PubMed:18283122 ]
  9. Kaizuka T, Hara T, Oshiro N, Kikkawa U, Yonezawa K, Takehana K, Iemura S, Natsume T, Mizushima N: Tti1 and Tel2 are critical factors in mammalian target of rapamycin complex assembly. J Biol Chem. 2010 Jun 25;285(26):20109-16. doi: 10.1074/jbc.M110.121699. Epub 2010 Apr 28. [PubMed:20427287 ]
  10. Bentley NJ, Holtzman DA, Flaggs G, Keegan KS, DeMaggio A, Ford JC, Hoekstra M, Carr AM: The Schizosaccharomyces pombe rad3 checkpoint gene. EMBO J. 1996 Dec 2;15(23):6641-51. [PubMed:8978690 ]
  11. Cimprich KA, Shin TB, Keith CT, Schreiber SL: cDNA cloning and gene mapping of a candidate human cell cycle checkpoint protein. Proc Natl Acad Sci U S A. 1996 Apr 2;93(7):2850-5. [PubMed:8610130 ]
  12. Mannino JL, Kim W, Wernick M, Nguyen SV, Braquet R, Adamson AW, Den Z, Batzer MA, Collins CC, Brown KD: Evidence for alternate splicing within the mRNA transcript encoding the DNA damage response kinase ATR. Gene. 2001 Jul 11;272(1-2):35-43. [PubMed:11470508 ]
  13. Keegan KS, Holtzman DA, Plug AW, Christenson ER, Brainerd EE, Flaggs G, Bentley NJ, Taylor EM, Meyn MS, Moss SB, Carr AM, Ashley T, Hoekstra MF: The Atr and Atm protein kinases associate with different sites along meiotically pairing chromosomes. Genes Dev. 1996 Oct 1;10(19):2423-37. [PubMed:8843195 ]
  14. Cliby WA, Roberts CJ, Cimprich KA, Stringer CM, Lamb JR, Schreiber SL, Friend SH: Overexpression of a kinase-inactive ATR protein causes sensitivity to DNA-damaging agents and defects in cell cycle checkpoints. EMBO J. 1998 Jan 2;17(1):159-69. [PubMed:9427750 ]
  15. Wright JA, Keegan KS, Herendeen DR, Bentley NJ, Carr AM, Hoekstra MF, Concannon P: Protein kinase mutants of human ATR increase sensitivity to UV and ionizing radiation and abrogate cell cycle checkpoint control. Proc Natl Acad Sci U S A. 1998 Jun 23;95(13):7445-50. [PubMed:9636169 ]
  16. Schmidt DR, Schreiber SL: Molecular association between ATR and two components of the nucleosome remodeling and deacetylating complex, HDAC2 and CHD4. Biochemistry. 1999 Nov 2;38(44):14711-7. [PubMed:10545197 ]
  17. Tibbetts RS, Brumbaugh KM, Williams JM, Sarkaria JN, Cliby WA, Shieh SY, Taya Y, Prives C, Abraham RT: A role for ATR in the DNA damage-induced phosphorylation of p53. Genes Dev. 1999 Jan 15;13(2):152-7. [PubMed:9925639 ]
  18. Kim ST, Lim DS, Canman CE, Kastan MB: Substrate specificities and identification of putative substrates of ATM kinase family members. J Biol Chem. 1999 Dec 31;274(53):37538-43. [PubMed:10608806 ]
  19. Hall-Jackson CA, Cross DA, Morrice N, Smythe C: ATR is a caffeine-sensitive, DNA-activated protein kinase with a substrate specificity distinct from DNA-PK. Oncogene. 1999 Nov 18;18(48):6707-13. [PubMed:10597277 ]
  20. Liu Q, Guntuku S, Cui XS, Matsuoka S, Cortez D, Tamai K, Luo G, Carattini-Rivera S, DeMayo F, Bradley A, Donehower LA, Elledge SJ: Chk1 is an essential kinase that is regulated by Atr and required for the G(2)/M DNA damage checkpoint. Genes Dev. 2000 Jun 15;14(12):1448-59. [PubMed:10859164 ]
  21. Tibbetts RS, Cortez D, Brumbaugh KM, Scully R, Livingston D, Elledge SJ, Abraham RT: Functional interactions between BRCA1 and the checkpoint kinase ATR during genotoxic stress. Genes Dev. 2000 Dec 1;14(23):2989-3002. [PubMed:11114888 ]
  22. Ward IM, Chen J: Histone H2AX is phosphorylated in an ATR-dependent manner in response to replicational stress. J Biol Chem. 2001 Dec 21;276(51):47759-62. Epub 2001 Oct 22. [PubMed:11673449 ]
  23. Cortez D, Guntuku S, Qin J, Elledge SJ: ATR and ATRIP: partners in checkpoint signaling. Science. 2001 Nov 23;294(5547):1713-6. [PubMed:11721054 ]
  24. Casper AM, Nghiem P, Arlt MF, Glover TW: ATR regulates fragile site stability. Cell. 2002 Dec 13;111(6):779-89. [PubMed:12526805 ]
  25. Hammond EM, Denko NC, Dorie MJ, Abraham RT, Giaccia AJ: Hypoxia links ATR and p53 through replication arrest. Mol Cell Biol. 2002 Mar;22(6):1834-43. [PubMed:11865061 ]
  26. Unsal-Kacmaz K, Makhov AM, Griffith JD, Sancar A: Preferential binding of ATR protein to UV-damaged DNA. Proc Natl Acad Sci U S A. 2002 May 14;99(10):6673-8. [PubMed:12011431 ]
  27. Barr SM, Leung CG, Chang EE, Cimprich KA: ATR kinase activity regulates the intranuclear translocation of ATR and RPA following ionizing radiation. Curr Biol. 2003 Jun 17;13(12):1047-51. [PubMed:12814551 ]
  28. Chini CC, Chen J: Human claspin is required for replication checkpoint control. J Biol Chem. 2003 Aug 8;278(32):30057-62. Epub 2003 May 24. [PubMed:12766152 ]
  29. Wang Y, Qin J: MSH2 and ATR form a signaling module and regulate two branches of the damage response to DNA methylation. Proc Natl Acad Sci U S A. 2003 Dec 23;100(26):15387-92. Epub 2003 Dec 3. [PubMed:14657349 ]
  30. Zou L, Elledge SJ: Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes. Science. 2003 Jun 6;300(5625):1542-8. [PubMed:12791985 ]
  31. Dierov J, Dierova R, Carroll M: BCR/ABL translocates to the nucleus and disrupts an ATR-dependent intra-S phase checkpoint. Cancer Cell. 2004 Mar;5(3):275-85. [PubMed:15050919 ]
  32. Ward IM, Minn K, Chen J: UV-induced ataxia-telangiectasia-mutated and Rad3-related (ATR) activation requires replication stress. J Biol Chem. 2004 Mar 12;279(11):9677-80. Epub 2004 Jan 23. [PubMed:14742437 ]
  33. Dart DA, Adams KE, Akerman I, Lakin ND: Recruitment of the cell cycle checkpoint kinase ATR to chromatin during S-phase. J Biol Chem. 2004 Apr 16;279(16):16433-40. Epub 2004 Feb 9. [PubMed:14871897 ]
  34. Andreassen PR, D'Andrea AD, Taniguchi T: ATR couples FANCD2 monoubiquitination to the DNA-damage response. Genes Dev. 2004 Aug 15;18(16):1958-63. [PubMed:15314022 ]
  35. Alderton GK, Joenje H, Varon R, Borglum AD, Jeggo PA, O'Driscoll M: Seckel syndrome exhibits cellular features demonstrating defects in the ATR-signalling pathway. Hum Mol Genet. 2004 Dec 15;13(24):3127-38. Epub 2004 Oct 20. [PubMed:15496423 ]
  36. Unsal-Kacmaz K, Sancar A: Quaternary structure of ATR and effects of ATRIP and replication protein A on its DNA binding and kinase activities. Mol Cell Biol. 2004 Feb;24(3):1292-300. [PubMed:14729973 ]
  37. Cortez D, Glick G, Elledge SJ: Minichromosome maintenance proteins are direct targets of the ATM and ATR checkpoint kinases. Proc Natl Acad Sci U S A. 2004 Jul 6;101(27):10078-83. Epub 2004 Jun 21. [PubMed:15210935 ]
  38. Falck J, Coates J, Jackson SP: Conserved modes of recruitment of ATM, ATR and DNA-PKcs to sites of DNA damage. Nature. 2005 Mar 31;434(7033):605-11. Epub 2005 Mar 2. [PubMed:15758953 ]
  39. O'Driscoll M, Ruiz-Perez VL, Woods CG, Jeggo PA, Goodship JA: A splicing mutation affecting expression of ataxia-telangiectasia and Rad3-related protein (ATR) results in Seckel syndrome. Nat Genet. 2003 Apr;33(4):497-501. Epub 2003 Mar 17. [PubMed:12640452 ]