You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification |
HMDB Protein ID
| HMDBP01315 |
Secondary Accession Numbers
| |
Name
| ATP synthase protein 8 |
Synonyms
|
- A6L
- F-ATPase subunit 8
|
Gene Name
| MT-ATP8 |
Protein Type
| Enzyme |
Biological Properties |
General Function
| Involved in hydrogen ion transmembrane transporter activity |
Specific Function
| Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane |
Pathways
|
Not Available
|
Reactions
| Not Available |
GO Classification
|
Component |
cell part |
membrane part |
mitochondrial proton-transporting atp synthase complex, coupling factor f(o) |
mitochondrial membrane part |
Function |
transmembrane transporter activity |
substrate-specific transmembrane transporter activity |
ion transmembrane transporter activity |
cation transmembrane transporter activity |
inorganic cation transmembrane transporter activity |
monovalent inorganic cation transmembrane transporter activity |
hydrogen ion transmembrane transporter activity |
transporter activity |
Process |
purine nucleotide metabolic process |
purine nucleotide biosynthetic process |
purine nucleoside triphosphate biosynthetic process |
purine ribonucleoside triphosphate biosynthetic process |
metabolic process |
nitrogen compound metabolic process |
cellular nitrogen compound metabolic process |
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process |
nucleobase, nucleoside and nucleotide metabolic process |
nucleoside phosphate metabolic process |
nucleotide metabolic process |
atp synthesis coupled proton transport |
atp biosynthetic process |
|
Cellular Location
|
- Mitochondrion membrane
- Single-pass membrane protein
|
Gene Properties |
Chromosome Location
| Not Available |
Locus
| Not Available |
SNPs
| MT-ATP8 |
Gene Sequence
|
>207 bp
ATGCCCCAACTAAATACTACCGTATGGCCCACCATAATTACCCCCATACTCCTTACACTA
TTCCTCATCACCCAACTAAAAATATTAAACACAAACTACCACCTACCTCCCTCACCAAAG
CCCATAAAAATAAAAAATTATAACAAACCCTGAGAACCAAAATGAACGAAAATCTGTTCG
CTTCATTCATTGCCCCCACAATCCTAG
|
Protein Properties |
Number of Residues
| 68 |
Molecular Weight
| 7991.6 |
Theoretical pI
| 10.56 |
Pfam Domain Function
|
|
Signals
|
|
Transmembrane Regions
|
|
Protein Sequence
|
>ATP synthase protein 8
MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICS
LHSLPPQS
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| P03928 |
UniProtKB/Swiss-Prot Entry Name
| ATP8_HUMAN |
PDB IDs
|
Not Available |
GenBank Gene ID
| J01415 |
GeneCard ID
| MT-ATP8 |
GenAtlas ID
| MT-ATP8 |
HGNC ID
| HGNC:7415 |
References |
General References
| - Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
- Anderson S, Bankier AT, Barrell BG, de Bruijn MH, Coulson AR, Drouin J, Eperon IC, Nierlich DP, Roe BA, Sanger F, Schreier PH, Smith AJ, Staden R, Young IG: Sequence and organization of the human mitochondrial genome. Nature. 1981 Apr 9;290(5806):457-65. [PubMed:7219534 ]
- Horai S, Hayasaka K, Kondo R, Tsugane K, Takahata N: Recent African origin of modern humans revealed by complete sequences of hominoid mitochondrial DNAs. Proc Natl Acad Sci U S A. 1995 Jan 17;92(2):532-6. [PubMed:7530363 ]
- Moilanen JS, Finnila S, Majamaa K: Lineage-specific selection in human mtDNA: lack of polymorphisms in a segment of MTND5 gene in haplogroup J. Mol Biol Evol. 2003 Dec;20(12):2132-42. Epub 2003 Aug 29. [PubMed:12949126 ]
- Ingman M, Kaessmann H, Paabo S, Gyllensten U: Mitochondrial genome variation and the origin of modern humans. Nature. 2000 Dec 7;408(6813):708-13. [PubMed:11130070 ]
- Ingman M, Gyllensten U: Mitochondrial genome variation and evolutionary history of Australian and New Guinean aborigines. Genome Res. 2003 Jul;13(7):1600-6. [PubMed:12840039 ]
- Coble MD, Just RS, O'Callaghan JE, Letmanyi IH, Peterson CT, Irwin JA, Parsons TJ: Single nucleotide polymorphisms over the entire mtDNA genome that increase the power of forensic testing in Caucasians. Int J Legal Med. 2004 Jun;118(3):137-46. Epub 2004 Feb 4. [PubMed:14760490 ]
- Marzuki S, Noer AS, Lertrit P, Thyagarajan D, Kapsa R, Utthanaphol P, Byrne E: Normal variants of human mitochondrial DNA and translation products: the building of a reference data base. Hum Genet. 1991 Dec;88(2):139-45. [PubMed:1757091 ]
- Rieder MJ, Taylor SL, Tobe VO, Nickerson DA: Automating the identification of DNA variations using quality-based fluorescence re-sequencing: analysis of the human mitochondrial genome. Nucleic Acids Res. 1998 Feb 15;26(4):967-73. [PubMed:9461455 ]
|