You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01321
Secondary Accession Numbers
  • 6617
Name Calcium/calmodulin-dependent protein kinase type 1
Synonyms
  1. CaM kinase I
  2. CaM kinase I alpha
  3. CaM-KI
  4. CaMKI-alpha
Gene Name CAMK1
Protein Type Unknown
Biological Properties
General Function Involved in protein kinase activity
Specific Function Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes like transcriptional regulation, hormone production, translational regulation, regulation of actin filament organization and neurite outgrowth. Involved in calcium- dependent activation of the ERK pathway. Recognizes the substrate consensus sequence [MVLIF]-x-R-x(2)-[ST]- x(3)-[MVLIF]. Phosphorylates EIF4G3/eIF4GII. In vitro phosphorylates CREB1, ATF1, CTFR, MYL9, SYN1/synapsin I and SYNII/synapsin II
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:3
Locus 3p25.3
SNPs CAMK1
Gene Sequence
>1113 bp
ATGCTGGGGGCAGTGGAAGGCCCCAGGTGGAAGCAGGCGGAGGACATTAGAGACATCTAC
GACTTCCGAGATGTTCTGGGCACGGGGGCCTTCTCGGAGGTGATCCTGGCAGAAGATAAG
AGGACGCAGAAGCTGGTGGCCATCAAATGCATTGCCAAGGAGGCCCTGGAGGGCAAGGAA
GGCAGCATGGAGAATGAGATTGCTGTCCTGCACAAGATCAAGCACCCCAACATTGTAGCC
CTGGATGACATCTATGAGAGTGGGGGCCACCTCTACCTCATCATGCAGCTGGTGTCGGGT
GGGGAGCTCTTTGACCGTATTGTGGAAAAAGGCTTCTACACGGAGCGGGACGCCAGCCGC
CTCATCTTCCAGGTGCTGGATGCTGTGAAATACCTGCATGACCTGGGCATTGTACACCGG
GATCTCAAGCCAGAGAATCTGCTGTACTACAGCCTGGATGAAGACTCCAAAATCATGATC
TCCGACTTTGGCCTCTCCAAGATGGAGGACCCGGGCAGTGTGCTCTCCACCGCCTGTGGA
ACTCCGGGATACGTGGCCCCTGAAGTCCTGGCCCAGAAGCCCTACAGCAAGGCTGTGGAT
TGCTGGTCCATAGGTGTCATCGCCTACATCTTGCTCTGCGGTTACCCTCCCTTCTATGAC
GAGAATGATGCCAAACTCTTTGAACAGATTTTGAAGGCCGAGTACGAGTTTGACTCTCCT
TACTGGGACGACATCTCTGACTCTGCCAAAGATTTCATCCGGCACTTGATGGAGAAGGAC
CCAGAGAAAAGATTCACCTGTGAGCAGGCCTTGCAGCACCCATGGATTGCAGGAGATACA
GCTCTAGATAAGAATATCCACCAGTCGGTGAGTGAGCAGATCAAGAAGAACTTTGCCAAG
AGCAAGTGGAAGCAAGCCTTCAATGCCACGGCTGTGGTGCGGCACATGAGGAAACTGCAG
CTGGGCACCAGCCAGGAGGGGCAGGGGCAGACGGCGAGCCATGGGGAGCTGCTGACACCA
GTGGCTGGGGGGCCGGCAGCTGGCTGTTGCTGTCGAGACTGCTGCGTGGAGCCGGGCACA
GAACTGTCCCCCACACTGCCCCACCAGCTCTAG
Protein Properties
Number of Residues 370
Molecular Weight 41336.7
Theoretical pI 4.92
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Calcium/calmodulin-dependent protein kinase type 1
MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKE
GSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASR
LIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACG
TPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSP
YWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK
SKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCCCRDCCVEPGT
ELSPTLPHQL
GenBank ID Protein 76827734
UniProtKB/Swiss-Prot ID Q14012
UniProtKB/Swiss-Prot Entry Name KCC1A_HUMAN
PDB IDs
GenBank Gene ID BC106754
GeneCard ID CAMK1
GenAtlas ID CAMK1
HGNC ID HGNC:1459
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. [PubMed:12665801 ]
  3. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  4. Haribabu B, Hook SS, Selbert MA, Goldstein EG, Tomhave ED, Edelman AM, Snyderman R, Means AR: Human calcium-calmodulin dependent protein kinase I: cDNA cloning, domain structure and activation by phosphorylation at threonine-177 by calcium-calmodulin dependent protein kinase I kinase. EMBO J. 1995 Aug 1;14(15):3679-86. [PubMed:7641687 ]
  5. Hsu LS, Tsou AP, Chi CW, Lee CH, Chen JY: Cloning, expression and chromosomal localization of human Ca2+/calmodulin-dependent protein kinase kinase. J Biomed Sci. 1998;5(2):141-9. [PubMed:9662074 ]
  6. Hsu LS, Chen GD, Lee LS, Chi CW, Cheng JF, Chen JY: Human Ca2+/calmodulin-dependent protein kinase kinase beta gene encodes multiple isoforms that display distinct kinase activity. J Biol Chem. 2001 Aug 17;276(33):31113-23. Epub 2001 Jun 6. [PubMed:11395482 ]
  7. Qin H, Raught B, Sonenberg N, Goldstein EG, Edelman AM: Phosphorylation screening identifies translational initiation factor 4GII as an intracellular target of Ca(2+)/calmodulin-dependent protein kinase I. J Biol Chem. 2003 Dec 5;278(49):48570-9. Epub 2003 Sep 24. [PubMed:14507913 ]